Cela1 (NM_033612) Mouse Tagged ORF Clone

CAT#: MR203526

Cela1 (Myc-DDK-tagged) - Mouse chymotrypsin-like elastase family, member 1 (Cela1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Cela1 (NM_033612) Mouse Tagged ORF Clone
Symbol Cela1
Synonyms 1810009A17Rik; 1810062B19Rik; Ela-1; Ela1; PC-TsF
Vector pCMV6-Entry
Sequence Data
>MR203526 representing NM_033612
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCGCTTCCTGGTGTTTGCTTCCCTGGTCCTGTGTGGACACAGTACCGAGGACGTTCCGGAAACTG
ACGCCCGCGTGGTTGGAGGGGCTGAAGCCCGGAGGAACTCTTGGCCGTCTCAGATTTCCCTCCAGTACCA
GTATGGAGGATCATGGCACCACACCTGTGGAGGCACCCTCATCCGAAGCAACTGGGTGATGACCGCTGCT
CACTGTGTGGACAGCCCCATGACTTATCGAGTGGTTGTCGGAGAGCACAACCTGAGCCAGAATGACGGCA
CCGAGCAGTATGTGAACGTGCAGAAGATTGTGTCACACCCCTACTGGAACAAGAACAACGTGGTTGCAGG
CTATGACATCGCCCTGCTGCGCTTGGCCAAGAGTGTTACACTCAATAACTATGTCCAGCTGGGTGTTCTG
CCCCGGGAGGGAACCATCCTGGCTAACAACTCTCCCTGCTACATCACAGGCTGGGGAAGAACCAGAACCA
ATGGGGAGCTGGCCCAGACCCTGCAGCAGGCATACCTGCCCAGCGTGTCCTATAGCATCTGCTCCAGCTC
CTCTTACTGGGGCTCCTCTGTGAAGAATACCATGGTGTGCGCTGGTGGAGATGGAGTCCGCTCTGGATGC
CAGGGTGATTCTGGGGGACCCCTCCACTGCATGGTGAACGGTCAGTATGCTGTCCACGGAGTGACCAGCT
TTGTGTCCAGCATGGGCTGTAATGTCGCCAGGAAGCCCACCGTCTTCACCAGAGTCTCTGCTTACATTTC
CTGGATGAATAATGTCATTGCCTCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203526 representing NM_033612
Red=Cloning site Green=Tags(s)

MLRFLVFASLVLCGHSTEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGGTLIRSNWVMTAA
HCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSVTLNNYVQLGVL
PREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSYSICSSSSYWGSSVKNTMVCAGGDGVRSGC
QGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVARKPTVFTRVSAYISWMNNVIASN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033612
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033612.1, NM_033612.2, NP_291090
RefSeq Size 1100
RefSeq ORF 801
Locus ID 109901
Cytogenetics 15 F1|15 56.38 cM
MW 29.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)