Apoa1 (NM_009692) Mouse Tagged ORF Clone

CAT#: MR203500

Apoa1 (Myc-DDK-tagged) - Mouse apolipoprotein A-I (Apoa1)

Change vector?

  • TrueORF®

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Apoa1 (NM_009692) Mouse Tagged ORF Clone
Symbol Apoa1
Synonyms Alp-1; apo-AI; Apoa-1; apoA-I; Brp-14; Ltw-1; Lvtw-1; Sep-1; Sep-2; Sep2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR203500 representing NM_009692
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGCTGTGGTGCTGGCCGTGGCTCTGGTCTTCCTGACAGGGAGCCAGGCTTGGCACGTATGGCAGC
AAGATGAACCCCAGTCCCAATGGGACAAAGTGAAGGATTTCGCTAATGTGTATGTGGATGCGGTCAAAGA
CAGCGGCAGAGACTATGTGTCCCAGTTTGAATCCTCCTCCTTGGGCCAACAGCTGAACCTGAATCTCCTG
GAAAACTGGGACACTCTGGGTTCAACCGTTAGTCAGCTGCAGGAACGGCTGGGCCCATTGACTCGGGACT
TCTGGGATAACCTGGAGAAAGAAACAGATTGGGTGAGACAGGAGATGAACAAGGACCTAGAGGAAGTGAA
ACAGAAGGTGCAGCCCTACCTGGACGAATTCCAGAAGAAATGGAAAGAGGATGTGGAGCTCTACCGCCAG
AAGGTGGCGCCTCTGGGCGCCGAGCTGCAGGAGAGCGCGCGCCAGAAGCTGCAGGAGCTGCAAGGGAGAC
TGTCCCCTGTGGCTGAGGAATTTCGCGACCGCATGCGCACACACGTAGACTCTCTGCGCACACAGCTAGC
GCCCCACAGCGAACAGATGCGCGAGAGCCTGGCCCAGCGCCTGGCTGAGCTCAAGAGCAACCCTACCTTG
AACGAGTACCACACCAGGGCCAAAACCCACCTGAAGACACTTGGCGAGAAAGCCAGACCTGCGCTGGAGG
ACCTGCGCCATAGTCTGATGCCCATGCTGGAGACGCTTAAGACCAAAGCCCAGAGTGTGATCGACAAGGC
CAGCGAGACTCTGACTGCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203500 representing NM_009692
Red=Cloning site Green=Tags(s)

MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLL
ENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQ
KVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTL
NEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKAQSVIDKASETLTAQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009692
ORF Size 792 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009692.1, NM_009692.2, NM_009692.3, NM_009692.4, NP_033822
RefSeq Size 924
RefSeq ORF 795
Locus ID 11806
Cytogenetics 9 A5.2|9 25.36 cM
MW 31.1 kDa
Gene Summary This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is the major protein component of plasma high density lipoprotein (HDL). This protein facilitates the removal of cholesterol and other fats from tissues by transporting them to the liver for excretion. This protein is a cofactor for lecithin cholesterolacyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. Mutations in this gene in humans causes familial HDL deficiency, Tangier disease and familial visceral amyloidosis. Similar clinical features are exhibited by mice with mutations in this gene. This gene is clustered with three other apolipoprotein genes on chromosome 9. [provided by RefSeq, Dec 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.