Sla2 (NM_029983) Mouse Tagged ORF Clone

CAT#: MR203346

  • TrueORF®

Sla2 (Myc-DDK-tagged) - Mouse Src-like-adaptor 2 (Sla2)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



  "NM_029983" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Sla2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sla2
Synonyms A930009E21Rik; AI430952; SLAP-2; SLAP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203346 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAGTTTGTCCAGCAGAGGGAAAACCTCCAGCCCCAGCCCCAGCTCCTCTGGTCCAGACCAGGAAC
CCGTGTCCATGCAACCAGAAAGACGCAAGGTCACAGCTGTGGCCCTGGGCAGTTTCCCAGCAGGTGAACA
GGCCAGACTATCTCTGAGACTCGGGGAGCCGCTGACCATCATCTCTGAGGATGGAGATTGGTGGACAGTC
CAGTCGGAAGTCTCAGGCAGAGAGTACCACATGCCCAGTGTGTATGTGGCTAAAGTCGCCCACGGGTGGC
TGTACGAGGGCCTGAGCCGGGAGAAAGCCGAGGAACTACTCCTGTTACCTGGGAACCCCGGAGGGGCCTT
CCTCATCCGGGAGAGCCAGACCAGGAGAGGCTGCTATTCCCTGTCCGTCCGACTCAGCCGCCCTGCATCT
TGGGACCGGATCAGACACTACAGGATACAGCGTCTTGACAATGGCTGGCTGTACATCTCACCTCGCCTCA
CCTTCCCCTCACTCCACGCCTTGGTGGAGCATTACTCTGAGCTAGCAGATGGCATCTGCTGTCCCCTCAG
GGAGCCGTGTGTCCTGCAGAAGCTTGGGCCACTACCTGGCAAAGATACACCTCCACCTGTGACTGTGCCA
ACATCATCACTAAATTGGAAAAAGCTGGACCGCAGCCTCCTGTTTCTGGAAGCACCTGCGAGTGGGGAGG
CATCTCTGCTCAGTGAGGGGCTCCGAGAGTCCCTCAGTTCCTACATCAGCCTGGCTGAGGACCCCTTGGA
TGATGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203346 protein sequence
Red=Cloning site Green=Tags(s)

MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERRKVTAVALGSFPAGEQARLSLRLGEPLTIISEDGDWWTV
QSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGCYSLSVRLSRPAS
WDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELADGICCPLREPCVLQKLGPLPGKDTPPPVTVP
TSSLNWKKLDRSLLFLEAPASGEASLLSEGLRESLSSYISLAEDPLDDA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_029983
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_029983.1, NM_029983.2, NM_029983.3, NM_029983.4, NM_029983.5, NP_084259.1
RefSeq Size 2508 bp
RefSeq ORF 780 bp
Locus ID 77799
UniProt ID Q8R4L0
Cytogenetics 2 H1
MW 28.5 kDa
Gene Summary Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.