Macrod1 (NM_134147) Mouse Tagged ORF Clone

CAT#: MR203012

  • TrueORF®

Macrod1 (Myc-DDK-tagged) - Mouse MACRO domain containing 1 (Macrod1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_134147" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 450.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Macrod1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Macrod1
Synonyms AI604841; AW743046; D930010J01Rik; Lrp16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203012 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGAAGGTGGACCTGAGCACCTCCACCGACTGGAAGGAGGCCAAATCCTTTCTGAAGGGCCTGA
GTGACAAGCAGAGAGAGGAACATTACTTCTGCAAGGATTTCATTAAGCTGAAGAAGATCCCCACGTGGAA
GGAGACAGCAAAAGGGCTGGCTGTGAAGGTGGAGGACCCCAAGTATAAGAAGGACAAGCAACTGAATGAG
AAAATCTCCCTGTACCGTGGGGACATCACCAAGCTGGAGGTGGATGCCATTGTCAACGCTGCCAACAGCT
CCCTGCTTGGAGGCGGAGGGGTGGACGGCTGCATTCATCGGGCCGCGGGATCCCTGCTCACGGACGAATG
CCGCACCCTACAGAACTGCGAGACCGGCAAAGCCAAGATCACTTGCGGCTATCGGCTGCCAGCCAAGTAT
GTCATCCACACGGTGGGGCCCATCGCCGTGGGCCAACCCACTGCCAGCCAGGCGGCCGAGCTCCGCAGCT
GCTACTTGAGCAGCCTGGACCTGCTGCTGGAGCACCGGCTGCGCTCAGTGGCTTTCCCGTGCATCTCCAC
AGGCGTGTTTGGCTACCCCAATGAGGAGGCTGCAGAAGTAGTGCTGGCTTCGCTGCGGGAATGGCTGGAG
CAGCACAAGGACAAGGTGGATCGGCTCATCATCTGTGTGTTCCTGGAGAAGGACGAGGGCATTTACCGGG
AGCGCCTGCCCCATTATTTCCCAGTAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203012 protein sequence
Red=Cloning site Green=Tags(s)

MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPTWKETAKGLAVKVEDPKYKKDKQLNE
KISLYRGDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKAKITCGYRLPAKY
VIHTVGPIAVGQPTASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPNEEAAEVVLASLREWLE
QHKDKVDRLIICVFLEKDEGIYRERLPHYFPVA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_134147
ORF Size 732 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_134147.1
RefSeq Size 1284 bp
RefSeq ORF 972 bp
Locus ID 107227
UniProt ID Q922B1
Cytogenetics 19 A
MW 27.1 kDa
Gene Summary Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety. Inactive towards proteins bearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen. May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction. Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. Enhances ESR1-mediated transcription activity.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.