Grb2 (NM_008163) Mouse Tagged ORF Clone

CAT#: MR202420

Grb2 (Myc-DDK-tagged) - Mouse growth factor receptor bound protein 2 (Grb2)

Product Images

Circular map for MR202420

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Grb2
• Synonyms: AA408164; Ash
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202420 representing NM_008163
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAAGCCATCGCCAAATATGACTTCAAAGCTACTGCTGACGATGAGCTGAGCTTCAAAAGGGGGGACA
  TCCTTAAGGTTTTGAATGAAGAATGTGACCAGAACTGGTATAAGGCAGAACTCAATGGGAAAGATGGCTT
  CATCCCCAAGAATTACATAGAAATGAAACCACATCCGTGGTTTTTTGGCAAAATCCCCAGAGCCAAGGCA
  GAAGAAATGCTCAGCAAACAGCGGCATGACGGGGCCTTCCTGATCCGAGAGAGCGAGAGCGCTCCTGGGG
  ACTTCTCCCTGTCCGTCAAGTTTGGAAATGATGTGCAGCACTTCAAGGTGCTCCGCGACGGAGCCGGGAA
  GTATTTCCTGTGGGTGGTGAAGTTTAATTCTTTGAATGAGCTGGTAGATTACCACAGATCAACATCCGTG
  TCCAGGAACCAGCAGATATTCTTACGGGACATAGAACAGATGCCACAGCAGCCAACCTACGTCCAGGCGC
  TCTTTGACTTTGACCCCCAGGAGGATGGCGAGCTGGGCTTTCGCAGAGGAGACTTCATTCATGTCATGGA
  TAACTCAGATCCCAATTGGTGGAAAGGGGCCTGCCACGGGCAGACCGGCATGTTTCCCCGCAATTATGTC
  ACCCCAGTGAACCGGAACGTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202420 representing NM_008163
  Red=Cloning site Green=Tags(s)
  
  MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKA
  EEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSV
  SRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYV
  TPVNRNV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_008163
• ORF Size: 651 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_008163.4, NP_032189.1
• RefSeq Size: 2624 bp
• RefSeq ORF: 654 bp
• Locus ID: 14784
• UniProt ID: Q60631
• Cytogenetics: 11 80.91 cM
• MW: 25.7 kDa
• Gene Summary: The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Three alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2015]