Gmnn (NM_020567) Mouse Tagged ORF Clone

CAT#: MR202178

Gmnn (Myc-DDK-tagged) - Mouse geminin (Gmnn)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Gmnn (NM_020567) Mouse Tagged ORF Clone
Symbol Gmnn
Synonyms AW546347; Gem
Vector pCMV6-Entry
Sequence Data
>MR202178 representing NM_020567
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCTCAGTATGAAGCAGAAGCAGGAGGGAGCCCAAGAGAATGTGAAGAATAGTCCTGTCCCAAGGA
GAACGCTGAAGATGATCCAGCCTTCTGCAGATGGATCTCTTGTTGGCAGAGAAAATGAGTTGCCAAAAGG
CTTGTTCAAAAGGAAGCTTTGGGATGACCAGCTAGCATCTCAGACTTCAAGCTGTGGTCCAGAAGCTAAT
GAAAATAAGGATGTTGGAGACCTCACCCAGGAAGCCTTTGATCTTATAAGTAAAGAGAACCCATCTTCTC
AGTATTGGAAAGAAGTGGCAGAGCAGCGGAGGAAAGCTCTCTACGAAGCACTGAAAGAGAATGAGAAACT
TCATAAAGAAATTGAACAAAAGGACAGTGAGATTGCCCGCCTGAGAAAGGAGAATAAAGACTTGGCAGAA
GTAGCTGAGCACGTGCAGTACATGGCGGAGGTAATCGAGAGGCTGAGTAATGAACCTCTGGATAACTTTG
AATCACCGGATAGTCAGGAATTTGATTCTGAAGAAGAAGCTGTTGAGTATTCAGAACTGGAAGACTCAGG
AGCTGGGACGTGTGCTGAAGAGACTGTGTCTTCCTCCACGGATGCTAGGCCGTGTACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202178 representing NM_020567
Red=Cloning site Green=Tags(s)

MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEAN
ENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAE
VAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020567
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020567.1, NM_020567.2, NP_065592
RefSeq Size 995
RefSeq ORF 621
Locus ID 57441
Cytogenetics 13|13 A3.1
MW 23.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)