Guca1b (NM_146079) Mouse Tagged ORF Clone

CAT#: MR202065

Guca1b (Myc-DDK-tagged) - Mouse guanylate cyclase activator 1B (Guca1b)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Guca1b (NM_146079) Mouse Tagged ORF Clone
Symbol Guca1b
Synonyms BC018258; GCAP2
Vector pCMV6-Entry
Sequence Data
>MR202065 representing NM_146079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCAGCAGCTGAGCTGGGAAGAGGCGGAGGCGGCCGGGGAGATGGATGTGGCGGAGTTGCAGGAGT
GGTACAAGAAGTTTGTCGTGGAGTGTCCCAGTGGGACGCTCTTCATGCACGAGTTCAAGCGCTTCTTCAA
GGTCACGGGCAATGAGGAGGCCAGCCAGTATGTAGAGAGCATGTTCCGAGCCTTCGACAAGAATGGGGAC
AACACCATTGACTTCCTGGAGTATGTGGCAGCCCTGAACCTCGTGCTGAGGGGCAGCCTGGAACACAAGC
TCAAGTGGACCTTCAAGATCTATGACAAGGACCGAAATGGCTGCATCGACCGCCTGGAACTCCTGGACAT
TGTGGAGGCGATTTACAAGCTGAAGAAAGCCTGCCGAGCGGAGCTGGATCTGGAACACCAGGGCCAGCTG
CTCACGCCCGAGGAGGTGGTGGACAGGATCTTCCTCCTGGTGGACGAGAATGGAGACGGCCAGCTGTCTC
TGACCGAGTTCATCGAGGGCGCCCGTCGCGATAAGTGGGTAATGAAGATGCTACAAATGGATATCAACCC
AGGCTGCTGGATCACGCAGCAGAGGCGGAGAAGCGCCATGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202065 representing NM_146079
Red=Cloning site Green=Tags(s)

MGQQLSWEEAEAAGEMDVAELQEWYKKFVVECPSGTLFMHEFKRFFKVTGNEEASQYVESMFRAFDKNGD
NTIDFLEYVAALNLVLRGSLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEHQGQL
LTPEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKMLQMDINPGCWITQQRRRSAMF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_146079
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_146079.1, NP_666191
RefSeq Size 1681
RefSeq ORF 606
Locus ID 107477
Cytogenetics 17|17 C
MW 24 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)