Fam213b (NM_025582) Mouse Tagged ORF Clone

CAT#: MR202055

Fam213b (Myc-DDK-tagged) - Mouse RIKEN cDNA 2810405K02 gene (2810405K02Rik)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fam213b (NM_025582) Mouse Tagged ORF Clone
Symbol Fam213b
Synonyms 2810405K02Rik; AI836168; PM/PGFS
Vector pCMV6-Entry
Sequence Data
>MR202055 representing NM_025582
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTGGTGGACCTTGGTCGCGTAGGAGCGTGTGTCTTGAAACATGCAGTGACTGGGGAGGCTGTGG
AGCTGCGGAGCCTATGGCAGGAGAAAGCTTGTGTGGTGGCCGGTCTGCGACGCTTCGGCTGCATGGTGTG
CCGCTGGATCGCCCAGGACCTCAGCAACCTCCGGAGCATCCTGGACCAACACGATGTGCGCCTGGTGGGC
GTGGGGCCTGAGGCCCTGGGCCTGCAGGAGTTTCTGGATGGTGGTTACTTCTCAGGAGAACTCTACCTTG
ATGAGAGCAAGCAAATCTATAAGGAGCTGGGCTTCAAGCGGTACAACAGCTTAAGCATCCTACCAGCTGC
CCTGGGAAAACCTGTTCGTGATGTAGCCTCCAAGGCTAAAGCTGTTGGTATCCAGGGGAACCTGTCTGGT
GACCTGCTGCAAAGTGGAGGGCTGCTGGTGGTCAGCAAGGGTGGCGACAAGGTACTGTTGCACTTCATCC
AGAAGTCCCCGGGTGACTATGTTCCCCAGGAGAACATCCTGCAGGCCTTGGGTATCTCTGCAGAGGTTTG
CTCCAGCAAGCCACCCCAGTGTGATGAAGAGGTGTGTGGGAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202055 representing NM_025582
Red=Cloning site Green=Tags(s)

MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRSILDQHDVRLVG
VGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSG
DLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_025582
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025582.2, NM_025582.3, NP_079858
RefSeq Size 786
RefSeq ORF 606
Locus ID 66469
Cytogenetics 4|4 E2
MW 22.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)