Rhob (NM_007483) Mouse Tagged ORF Clone

CAT#: MR201939

Rhob (Myc-DDK-tagged) - Mouse ras homolog gene family, member B (Rhob)

Product Images

Circular map for MR201939

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rhob
• Synonyms: AA017882; Arh6; Arhb
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201939 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGCCATCCGCAAGAAGCTGGTGGTGGTGGGCGACGGCGCGTGCGGCAAGACGTGCCTGCTGATCG
  TGTTCAGTAAAGACGAATTCCCCGAGGTGTACGTGCCCACCGTGTTCGAGAACTATGTGGCGGACATCGA
  GGTGGACGGCAAGCAGGTGGAGCTGGCGCTGTGGGACACGGCAGGCCAGGAGGACTACGATCGTTTACGG
  CCGCTCTCCTATCCGGACACCGACGTCATCCTTATGTGCTTCTCGGTGGACAGCCCGGACTCTCTCGAGA
  ACATCCCCGAGAAGTGGGTGCCCGAGGTAAAGCACTTCTGCCCCAATGTGCCCATCATCCTGGTGGCCAA
  CAAAAAAGACCTGCGCAGCGACGAGCATGTCCGCACGGAGCTGGCCCGCATGAAGCAGGAGCCAGTGCGC
  ACGGATGACGGCCGCGCCATGGCGGTGCGCATCCAAGCCTATGACTACCTCGAGTGCTCGGCCAAGACCA
  AGGAGGGCGTGCGCGAGGTTTTTGAGACGGCCACGCGCGCCGCGCTGCAGAAGCGCTACGGATCCCAGAA
  TGGCTGCATCAACTGCTGCAAGGTGCTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201939 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
  PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
  TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_007483
• ORF Size: 591 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_007483.3
• RefSeq Size: 2264 bp
• RefSeq ORF: 591 bp
• Locus ID: 11852
• UniProt ID: P62746
• Cytogenetics: 12 A1.1
• MW: 22.1 kDa
• Gene Summary: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.[UniProtKB/Swiss-Prot Function]