Rnf4 (NM_011278) Mouse Tagged ORF Clone

CAT#: MR201893

Rnf4 (Myc-DDK-tagged) - Mouse ring finger protein 4 (Rnf4)

Product Images

Circular map for MR201893

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rnf4
• Synonyms: AU018689; Gtrge; Gtrgeo8; SNURF
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201893 representing NM_011278
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTACAAGAAATCCTCAAAGAAAGCGGCGTGGTGGAACTGTGAATTCTAGACAAACCCAGAAGCGAA
  CTCGGGAAACAACTTCGACCCCTGAGGTTTCCTTGGAAACAGAACCCATAGAACTTGTGGAAACTGTTGG
  AGATGAAATTGTGGACCTCACCTGTGAATCTTTAGAGCCCGTGGTTGTGGACCTGACTCACAATGACTCT
  GTTGTGATTGTTGAAGAAAGGAGAAGGCCAAGGAGAAATGGGAGGAGGTTGCGCCAAGACCATGCTGACA
  GCTGTGTGGTGAGCAGTGATGATGAGGAGCTGTCTAGGGACAAAGATGTGTACGTGACTACCCATACTCC
  TCGAAGCACCAAGGATGATGGAGCTACTGGACCCAGGCCCTCAGGTACCGTCAGTTGTCCTATCTGTATG
  GATGGATACTCTGAGATTGTGCAGAATGGGCGTCTCATTGTTTCTACAGAATGTGGCCACGTCTTCTGTA
  GCCAGTGCCTCCGTGATTCCCTTAAGAATGCTAACACTTGCCCAACTTGTAGGAAAAAGATCAACCATAA
  GCGGTACCACCCCATTTATATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201893 representing NM_011278
  Red=Cloning site Green=Tags(s)
  
  MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEPVVVDLTHNDS
  VVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSRDKDVYVTTHTPRSTKDDGATGPRPSGTVSCPICM
  DGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_011278
• ORF Size: 582 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_011278.5
• RefSeq Size: 2936 bp
• RefSeq ORF: 585 bp
• Locus ID: 19822
• UniProt ID: Q9QZS2
• Cytogenetics: 5 B2
• MW: 22.4 kDa
• Gene Summary: This gene encodes a small nuclear RING finger protein that mediates ubiquitylation of polysumoylated proteins. Deficiency of the encoded protein in mice leads to embryonic lethality and global DNA hypermethylation. A similar protein in humans is required for arsenic-induced degradation of promyelocytic leukemia protein in acute promyelocytic leukemia. Alternative splicing of this gene results in multiple transcript variants. A pseudogene for this gene has been identified on chromosome 10. [provided by RefSeq, Jan 2015]