Nme4 (NM_019731) Mouse Tagged ORF Clone
CAT#: MR201741
- TrueORF®
Nme4 (Myc-DDK-tagged) - Mouse non-metastatic cells 4, protein expressed in (Nme4), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_019731" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Nme4 |
Synonyms | 2610027N22Rik; 2810024O08Rik; 5730493H09Rik; NM23-M4; Nm23M4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201741 representing NM_019731
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCAGCCTTTTCGGGCGCGTCGCGGCGCTGCGGGCGCTGTTGTGCGGGCCACGCTTTCAGTGCCTGC TGGTGCGCCCCAGTTCCGGAGGCCCCCCCTGGCCCCAAGAGCGGACGCTGGTTGCTGTGAAGCCAGATGG GGTACAGAGGAGACTAGTGGGGACTGTGATACAACGCTTTGAGAGGCGGGGCTTCAAGCTCGTGGGGATG AAGATGCTGCAGGCACCAGAAAGCATCCTTGCTGAGCACTACCGGGACCTACAGAGGAAGCCATTCTACC CAGCTCTTATCAGCTACATGAGCTCTGGGCCTGTGGTGGCCATGGTCTGGGAAGGCCCCAATGTGGTCCA TATCTCAAGGGCCATGATAGGACACACCGACTCAACAGAGGCAGCCCCCGGGACAATCAGGGGCGACTTC AGTGTTCACATCAGCAGGAACGTCATCCATGCTAGCGATTCTGTGGATGGGGCCCAGAGGGAGATCGAGC TGTGGTTTCAGAGCAGCGAACTGTTGAACTGGGCAGATGGTGGTCACCACAGCAGCTGCTACCCTGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201741 representing NM_019731
Red=Cloning site Green=Tags(s) MGSLFGRVAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGM KMLQAPESILAEHYRDLQRKPFYPALISYMSSGPVVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDF SVHISRNVIHASDSVDGAQREIELWFQSSELLNWADGGHHSSCYPA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_019731 |
ORF Size | 558 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_019731.1, NP_062705.1 |
RefSeq Size | 863 bp |
RefSeq ORF | 561 bp |
Locus ID | 56520 |
UniProt ID | Q9WV84 |
Cytogenetics | 17 A3.3 |
MW | 21 kDa |
Gene Summary | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Through the catalyzed exchange of gamma-phosphate between di- and triphosphonucleosides participates in regulation of intracellular nucleotide homeostasis. Binds to anionic phospholipids, predominantly to cardiolipin; the binding inhibits its phosphotransfer activity. Acts as mitochondria-specific NDK; its association with cardiolipin-containing mitochondrial inner membrane is coupled to respiration suggesting that ADP locally regenerated in the mitochondrion innermembrane space by its activity is directly taken up via ANT ADP/ATP translocase into the matrix space to stimulate respiratory ATP regeneration. Proposed to increase GTP-loading on dynamin-related GTPase OPA1 in mitochondria. In vitro can induce liposome cross-linking suggesting that it can cross-link inner and outer membranes to form contact sites, and promotes intermembrane migration of anionic phosphoplipids. Promotes the redistribution of cardiolipin between the mitochondrial inner membrane and outer membrane which is implicated in pro-apoptotic signaling (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC201533 | Nme4 (untagged) - Mouse non-metastatic cells 4, protein expressed in (Nme4), nuclear gene encoding mitochondrial protein, (10ug) |
USD 300.00 |
|
MG201741 | Nme4 (tGFP-tagged) - Mouse expressed in non-metastatic cells 4, protein (Nme4) |
USD 500.00 |
|
MR201741L3 | Lenti ORF clone of Nme4 (Myc-DDK-tagged) - Mouse non-metastatic cells 4, protein expressed in (Nme4), nuclear gene encoding mitochondrial protein |
USD 600.00 |
|
MR201741L4 | Lenti ORF clone of Nme4 (mGFP-tagged) - Mouse non-metastatic cells 4, protein expressed in (Nme4), nuclear gene encoding mitochondrial protein |
USD 600.00 |
{0} Product Review(s)
Be the first one to submit a review