Copz1 (BC110679) Mouse Tagged ORF Clone

CAT#: MR201551

Copz1 (Myc-DDK-tagged) - Mouse coatomer protein complex, subunit zeta 1 (cDNA clone MGC:118060 IMAGE:3492292)

Product Images

Circular map for MR201551

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Copz1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201551 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGGCGCTGATTTTGGAGCCCTCCCTGTACACTGTCAAGGCCATCCTGATTCTGGACAATGATGGAG
  ACCGACTCTTCGCCAAGTACTATGACGACACCTACCCCAGTGTCAAGGAGCAAAAGGCCTTTGAGAAGAA
  CATTTTCAACAAGACCCATCGGACGGATAGTGAAATCGCTCTGTTGGAAGGATTGACAGTGGTCTATAAA
  AGTAGCATCGATCTCTATTTCTATGTGATTGGCAGCTCCTATGAAAATGAGCTGATGCTTATGGCTGTTC
  TGAACTGCCTCTTCGATTCCCTGAGCCAGATGCTGAGGAAAAATGTAGAAAAGCGAGCTTTGCTGGAGAA
  CATGGAGGGCCTCTTCTTGGCTGTGGATGAAATTGTAGATGGAGGGGTGATCCTAGAGAGCGACCCCCAG
  CAAGTGGTGCACCGGGTGGCTTTGAGGGGTGAAGACGTCCCCCTTACAGAGCAGACCGTGTCTCAGGTGC
  TGCAGTCAGCCAAAGAACAGATCAAGTGGTCCCTCCTTCGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201551 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK
  SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ
  QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC110679
• ORF Size: 531 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC110679
• RefSeq Size: 2059 bp
• RefSeq ORF: 533 bp
• Locus ID: 56447
• Cytogenetics: 15 58.74 cM
• MW: 20.2 kDa
• Gene Summary: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).[UniProtKB/Swiss-Prot Function]