Pmch (NM_029971) Mouse Tagged ORF Clone

CAT#: MR201335

Pmch (Myc-DDK-tagged) - Mouse pro-melanin-concentrating hormone (Pmch)

Product Images

Circular map for MR201335

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Pmch
• Synonyms: A230109K23Rik
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201335 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAAAGATGACTCTCTCTTCCTACATGTTAATGCTGGCTTTTTCTTTGTTTTCTCAAGGTATTTTAC
  TTTCAGCTTCCAAGTCCATAAGGAATTTGGAAGATGACATAGTATTTAATACATTTCGAATGGGGAAAGC
  CTTTCAGAAGGAAGATACTGCAGAAAGATCCGTTGTCGCCCCTTCTCTGGAACAATACAAAAACGACGAG
  AGCGGTTTCATGAACGATGATGACAATAAGAATTCAAAGAACACAGGCTCCAAACAGAATCTTGTAACTC
  ACGGGCTGCCACTGAGTCTGGCTGTAAAACCTTACCTCGCTCTGAAAGGATCCGTAGCCTTCCCAGCTGA
  GAATGGAGTTCAGAATGCTGAGTCCACACAGGAAAAGAGAGAAACTGGGGATGAAGAAAACTCAGCTAAA
  TTTCCCATAGGAAGGAGAGATTTTGACATGCTCAGGTGTATGCTGGGAAGAGTCTACCGACCATGTTGGC
  AAGTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201335 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKMTLSSYMLMLAFSLFSQGILLSASKSIRNLEDDIVFNTFRMGKAFQKEDTAERSVVAPSLEQYKNDE
  SGFMNDDDNKNSKNTGSKQNLVTHGLPLSLAVKPYLALKGSVAFPAENGVQNAESTQEKRETGDEENSAK
  FPIGRRDFDMLRCMLGRVYRPCWQV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_029971
• ORF Size: 498 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_029971.1, NM_029971.2, NP_084247.1
• RefSeq Size: 748 bp
• RefSeq ORF: 498 bp
• Locus ID: 110312
• UniProt ID: P56942
• Cytogenetics: 10 43.7 cM
• MW: 18.5 kDa
• Gene Summary: This gene encodes a preproprotein that is cleaved to produce three mature peptides: melanin concentrating hormone, neuropeptide-glutamic acid-isoleucine (NEI), and neuropeptide-glycine-glutamic acid (NGE). The proprotein is processed differently depending on the tissue where it is expressed. Melanin concentrating hormone is involved in the regulation of food intake, energy homeostasis, and sleep-wake behavior. Disruption of this gene is associated with resistance to diet-induced obesity. [provided by RefSeq, May 2013]