Hscb (NM_153571) Mouse Tagged ORF Clone

CAT#: MR201219

Reviews ()
Write a review
  • TrueORF®

Hscb (Myc-DDK-tagged) - Mouse HscB iron-sulfur cluster co-chaperone homolog (E. coli) (Hscb)



Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 150.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Hscb"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Hscb
Synonyms AI325508; AW049829; Hsc20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201219 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTGCAACCGCTCCTTCAGGGTGGACGTTACGAAACTTCAGCACAGGTACCAGCAACTGCAGCGGC
TTGTCCACCCAGATTTCTTCAGCCAAAAGTCTCAGACTGAAAAACACTTCTCTGACAAGCACTCCACCCT
GGTGAATGATGCCTATAAGACTCTTCAGGCTCCCCTGACCAGAGGACTATATCTTCTAAAGCTCCAGGGA
ATAGAAATTCCTGAAGGGACAGATTACAAAGCAGACAGTCAGTTCCTTGTGGAAATCATGGAAATCAATG
AAAGACTCGCAGACGCCCAAAGTGAGGCCGCCATGGAAGAGATAGAAGCCACTGTCAGAGCTAAACAGAA
AGAATTTACTGACAATATAAACAGCGCTTTTGAACAAGGTGACTTTGAAAAAGCCAAGGAACTCCTGACA
AAGATGAGATACTTTTCGAACATAGAAGAAAAGATCAAGCTAAGCAAGACTCCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201219 protein sequence
Red=Cloning site Green=Tags(s)

MNCNRSFRVDVTKLQHRYQQLQRLVHPDFFSQKSQTEKHFSDKHSTLVNDAYKTLQAPLTRGLYLLKLQG
IEIPEGTDYKADSQFLVEIMEINERLADAQSEAAMEEIEATVRAKQKEFTDNINSAFEQGDFEKAKELLT
KMRYFSNIEEKIKLSKTPL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_153571
ORF Size 480 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_153571.1, NP_705799.1
RefSeq Size 825 bp
RefSeq ORF 705 bp
Locus ID 100900
UniProt ID Q8K3A0
Cytogenetics 5 F
MW 18.5 kDa
Gene Summary Acts as a co-chaperone in iron-sulfur cluster assembly in both mitochondria and the cytoplasm. Required for incorporation of iron-sulfur clusters into SDHB, the iron-sulfur protein subunit of succinate dehydrogenase that is involved in complex II of the mitochondrial electron transport chain. Recruited to SDHB by interaction with SDHAF1 which first binds SDHB and then recruits the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20. Also mediates complex formation between components of the cytosolic iron-sulfur biogenesis pathway and the CIA targeting complex composed of CIAO1, DIPK1B/FAM69B and MMS19 by binding directly to the scaffold protein ISCU and to CIAO1. This facilitates iron-sulfur cluster insertion into a number of cytoplasmic and nuclear proteins including POLD1, ELP3, DPYD and PPAT.[UniProtKB/Swiss-Prot Function]
Order online and get additional $20 off!
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.