H19 (BC025150) Mouse Tagged ORF Clone

CAT#: MR201007

H19 (Myc-DDK-tagged) - Mouse H19 fetal liver mRNA (cDNA clone MGC:35822 IMAGE:3592592)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 320.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name H19 (BC025150) Mouse Tagged ORF Clone
Symbol H19
Vector pCMV6-Entry
Sequence Data
>MR201007 representing BC025150
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGGCGCCTTGTCGTAGAAGCCGTCTGTTCTTTCACTTTTCCCAAAGAGCTAACACTTCTCTGCT
GCTCTCTGGATCCTCCTCCCCCTACCTTGAACCCTCAAGATGAAAGAAATGGTGCTACCCAGCTCATGTC
TGGGCCTTTGAATCCGGGGACTTCTTTAAGTCCGTCTCGTTCTGAATCAAGAAGATGCTGCAATCAGAAC
CACTACACTACCTGCCTCAGGAATCTGCTCCAAGGTGAAGCTGAAAGAACAGATGGTGTCAACATTTTGA
AAGAGCAGACTCATAGCACCCACCCACCCCTGAGAATCCATCTTCATGGCCAACTCTGCCTGACCCGGGA
GACCACCACCCACATCATCCTGGAGCCAAGCCTCTACCCCGGGATGACTTCATCATCTCCCTCCTGTCTT
TTTCTTCTTCCTCCTTTCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201007 representing BC025150
Red=Cloning site Green=Tags(s)

MGWRLVVEAVCSFTFPKELTLLCCSLDPPPPTLNPQDERNGATQLMSGPLNPGTSLSPSRSESRRCCNQN
HYTTCLRNLLQGEAERTDGVNILKEQTHSTHPPLRIHLHGQLCLTRETTTHIILEPSLYPGMTSSSPSCL
FLLPPFL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC025150
ORF Size 441 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC025150
RefSeq Size 1171
RefSeq ORF 443
Locus ID 14955
Cytogenetics 7 F5|7 87.97 cM
MW 42.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)