Pla2g2a (NM_001082531) Mouse Tagged ORF Clone

CAT#: MR200976

Pla2g2a (Myc-DDK-tagged) - Mouse phospholipase A2, group IIA (platelets, synovial fluid) (Pla2g2a)

Product Images

Circular map for MR200976

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Pla2g2a
• Synonyms: EF; Mom1; Pla2; sPLA2; sPla2-IIA
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200976 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGGTCCTCCTGCTGCTAGCAGCCTCGATCATGGCCTTTGGCTCAATACAGGTCCAAGGGAACATTG
  CGCAGTTTGGGGAAATGATTCGGCTTAAGACAGGAAAGAGAGCTGAGCTTAGCTATGCCTTCTATGGATG
  CCACTGTGGCCTGGGTGGCAAAGGATCCCCCAAGGATGCCACAGACCGGTGCTGTGTTACTCATGACTGT
  TGCTACAAGAGCCTGGAGAAAAGTGGATGTGGTACTAAGTTACTGAAATACAAGTACTCCCACCAAGGGG
  GCCAAATCACCTGTTCTGCAAACCAGAACTCCTGTCAGAAACGGCTGTGTCAGTGCGATAAAGCCGCCGC
  TGAATGTTTCGCCCGGAACAAGAAAACCTACAGTTTAAAGTACCAGTTCTACCCCAACATGTTTTGCAAA
  GGGAAGAAGCCCAAATGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200976 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDC
  CYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCK
  GKKPKC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001082531
• ORF Size: 441 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001082531.1, NP_001076000.1
• RefSeq Size: 793 bp
• RefSeq ORF: 441 bp
• Locus ID: 18780
• UniProt ID: P31482
• Cytogenetics: 4 70.57 cM
• MW: 16.1 kDa
• Gene Summary: Proteins belonging to the phospholipase A2 (PLA2) family hydrolyze phospholipids into sn2 fatty acids and lysophospholipids. They function in a variety of cellular processes, including the digestion of phospholipids and the production of molecules that induce inflammatory responses. This gene encodes a member of the group II class of secretory PLA2s. The secreted enzyme binds to heparin on the cell surface. Mutations in this gene increase the occurrence of intestinal polyps caused by a dominant mutation in the adenomatosis polyposis coli gene. A frameshift inactivates this gene product in some mouse strains including the strain of the reference genome, C57BL/6J, whereas a functional protein is produced in other strains. [provided by RefSeq, Jul 2008]