Tmem100 (NM_026433) Mouse Tagged ORF Clone

CAT#: MR200801

Tmem100 (Myc-DDK-tagged) - Mouse transmembrane protein 100 (Tmem100)

Product Images

Circular map for MR200801

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Tmem100
• Synonyms: 1810057C19Rik; AV011897
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200801 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCGAAGAATCCACAAAAGAGAACCTGGGAGCTCCAAAATCTCCCACACCTGTGACAATGGAGAAAA
  ACCCCAAGAGGGAAGTTGTGGTCACCACGGGACCCTTGGTCAGCGAGGTTCAGCTGATGGCCGCCACCGG
  GGGTGCCGAACTCTCCTGCTACCGCTGCATCATCCCCTTTGCCGTGGTGGTCTTCATCACTGGGATTGTG
  GTCACCGCTGTGGCTTACAGCTTCAATTCCCATGGTTCCATCATCTCCATCTTCGGCCTGGTCCTTCTGT
  CCTCCGGACTGTTTTTACTAGCCTCCAGTGCCTTGTGCTGGAAGGTGAGACAAAGGAACAAGAAAGTCAA
  GAGACGCGAGAGTCAGACCGCTCTTGTGGTAAATCAGAGGTGCTTGTTTGCT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200801 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPFAVVVFITGIV
  VTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRCLFA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026433
• ORF Size: 405 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_026433.2
• RefSeq Size: 1764 bp
• RefSeq ORF: 405 bp
• Locus ID: 67888
• UniProt ID: Q9CQG9
• Cytogenetics: 11 C
• MW: 14.5 kDa
• Gene Summary: Plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor-dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10 (PubMed:22783020). Involved in the regulation of nociception, acting as a modulator of the interaction between TRPA1 and TRPV1, two molecular sensors and mediators of pain signals in dorsal root ganglia (DRG) neurons (PubMed:25640077). Mechanistically, it weakens their interaction, thereby releasing the inhibition of TRPA1 by TRPV1 and increasing the single-channel open probability of the TRPA1-TRPV1 complex (PubMed:25640077).[UniProtKB/Swiss-Prot Function]