Vma21 (NM_001081356) Mouse Tagged ORF Clone

CAT#: MR200313

Vma21 (Myc-DDK-tagged) - Mouse VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) (Vma21)

Change vector?

  • TrueORF®

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Vma21 (NM_001081356) Mouse Tagged ORF Clone
Symbol Vma21
Synonyms 2610030H06Rik; AI840175
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR200313 representing NM_001081356
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGTCTTGATAAAGCAGCGCTCAATGCGCTGCAGCCTCCAGAGTTCAGAAATGAAAACTCTTTAG
CTGCAACCCTGAAGACACTGCTGTTCTTCACAGCTTTAATGATCACGGTTCCTATCGGCTTGTATTTTAC
AACGAAAGCTTATATATTTGAAGGTGCCCTTGGAATGTCTAATAGAGACAGCTATTTTTATGCCGCAATT
GTTGCTGTTGTTGCTGTTCATGTGGTTCTGGCCCTGTTTGTCTATGTGGCCTGGAATGAAGGCTCACGAC
AGTGGCGTGAAGGCAAACAGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200313 representing NM_001081356
Red=Cloning site Green=Tags(s)

MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAI
VAVVAVHVVLALFVYVAWNEGSRQWREGKQD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001081356
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001081356.1, NM_001081356.2, NM_001081356.3, NP_001074825
RefSeq Size 4174
Locus ID 67048
Cytogenetics X|X A7.3
MW 11.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.