Hcst (BC069220) Mouse Tagged ORF Clone

CAT#: MR200079

Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698)

Specifications

Product Data

• Product Name: Hcst (BC069220) Mouse Tagged ORF Clone
• Symbol: Hcst
• Synonyms: DAP10, KAP10
• Vector: pCMV6-Entry
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200079 representing BC069220
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCCCCCAGGCTACCTCCTGTTCCTGCTTCTGCTCCCAGGTTCCTGCTCCGGATGTGGGACTCTGT
  CTCTGCCACTCCTGGCAGGCCTAGTGGCTGCAGATGCGGTCATGTCACTCCTAATTGTAGGGGTGGTGTT
  TGTATGTATGCGCCCACACGGCAGGCCTGCCCAAGAAGATGGTAGAGTCTACATCAACATGCCTGGCAGA
  GGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200079 representing BC069220
  Red=Cloning site Green=Tags(s)
  
  MDPPGYLLFLLLLPGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGRVYINMPGR
  G
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• Tag: Myc-DDK
• ACCN: BC069220
• ORF Size: 213 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: BC069220
• RefSeq Size: 487
• RefSeq ORF: 215
• Locus ID: 23900
• Cytogenetics: 7 B1|7 17.45 cM
• MW: 17.8 kDa