Hcst (BC069220) Mouse Tagged ORF Clone

CAT#: MR200079

Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 310.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Hcst (BC069220) Mouse Tagged ORF Clone
Symbol Hcst
Synonyms DAP10, KAP10
Vector pCMV6-Entry
Sequence Data
>MR200079 representing BC069220
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCCCAGGCTACCTCCTGTTCCTGCTTCTGCTCCCAGGTTCCTGCTCCGGATGTGGGACTCTGT
CTCTGCCACTCCTGGCAGGCCTAGTGGCTGCAGATGCGGTCATGTCACTCCTAATTGTAGGGGTGGTGTT
TGTATGTATGCGCCCACACGGCAGGCCTGCCCAAGAAGATGGTAGAGTCTACATCAACATGCCTGGCAGA
GGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200079 representing BC069220
Red=Cloning site Green=Tags(s)

MDPPGYLLFLLLLPGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGRVYINMPGR
G

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC069220
ORF Size 213 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC069220
RefSeq Size 487
RefSeq ORF 215
Locus ID 23900
Cytogenetics 7 B1|7 17.45 cM
MW 17.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)