Ptgs2 (NM_011198) Mouse Tagged ORF Clone

CAT#: MG227684

Ptgs2 (GFP-tagged) - Mouse prostaglandin-endoperoxide synthase 2 (Ptgs2), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 845.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ptgs2 (NM_011198) Mouse Tagged ORF Clone
Symbol Ptgs2
Synonyms Cox-2; COX2; gripghs; PES-2; PGHS-2; Pghs2; PHS II; PHS-2; TIS10
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG227684 representing NM_011198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCTTCCGAGCTGTGCTGCTCTGCGCTGCCCTGGGGCTCAGCCAGGCAGCAAATCCTTGCTGTTCCA
ATCCATGTCAAAACCGTGGGGAATGTATGAGCACAGGATTTGACCAGTATAAGTGTGACTGTACCCGGAC
TGGATTCTATGGTGAAAACTGTACTACACCTGAATTTCTGACAAGAATCAAATTACTGCTGAAGCCCACC
CCAAACACAGTGCACTACATCCTGACCCACTTCAAGGGAGTCTGGAACATTGTGAACAACATCCCCTTCC
TGCGAAGTTTAATCATGAAATATGTGCTGACATCCAGATCATATTTGATTGACAGTCCACCTACTTACAA
TGTGCACTATGGTTACAAAAGCTGGGAAGCCTTCTCCAACCTCTCCTACTACACCAGGGCCCTTCCTCCC
GTAGCAGATGACTGCCCAACTCCCATGGGTGTGAAGGGAAATAAGGAGCTTCCTGATTCAAAAGAAGTGC
TGGAAAAGGTTCTTCTACGGAGAGAGTTCATCCCTGACCCCCAAGGCTCAAATATGATGTTTGCATTCTT
TGCCCAGCACTTCACCCATCAGTTTTTCAAGACAGATCATAAGCGAGGACCTGGGTTCACCCGAGGACTG
GGCCATGGAGTGGACTTAAATCACATTTATGGTGAAACTCTGGACAGACAACATAAACTGCGCCTTTTCA
AGGATGGAAAATTGAAATATCAGGTCATTGGTGGAGAGGTGTATCCCCCCACAGTCAAAGACACTCAGGT
AGAGATGATCTACCCTCCTCACATCCCTGAGAACCTGCAGTTTGCTGTGGGGCAGGAAGTCTTTGGTCTG
GTGCCTGGTCTGATGATGTATGCCACCATCTGGCTTCGGGAGCACAACAGAGTGTGCGACATACTCAAGC
AGGAGCATCCTGAGTGGGGTGATGAGCAACTATTCCAAACCAGCAGACTCATACTCATAGGAGAGACTAT
CAAGATAGTGATCGAAGACTACGTGCAACACCTGAGCGGTTACCACTTCAAACTCAAGTTTGACCCAGAG
CTCCTTTTCAACCAGCAGTTCCAGTATCAGAACCGCATTGCCTCTGAATTCAACACACTCTATCACTGGC
ACCCCCTGCTGCCCGACACCTTCAACATTGAAGACCAGGAGTACAGCTTCAAACAGTTTCTCTACAACAA
CTCCATCCTCCTGGAACATGGACTCACTCAGTTTGTTGAGTCATTCACCAGACAGATTGCTGGCCGGGTT
GCTGGGGGAAGAAATGTGCCAATTGCTGTACAAGCAGTGGCAAAGGCCTCCATTGACCAGAGCAGAGAGA
TGAAATACCAGTCTCTCAATGAGTACCGCAAACGCTTCTCCCTGAAGCCGTACACATCATTTGAAGAACT
TACAGGAGAGAAGGAAATGGCTGCAGAATTGAAAGCCCTCTACAGTGACATCGATGTCATGGAACTGTAC
CCTGCCCTGCTGGTGGAAAAACCTCGTCCAGATGCTATCTTTGGGGAGACCATGGTAGAGCTTGGAGCAC
CATTCTCCTTGAAAGGACTTATGGGAAATCCCATCTGTTCTCCTCAATACTGGAAGCCGAGCACCTTTGG
AGGCGAAGTGGGTTTTAAGATCATCAATACTGCCTCAATTCAGTCTCTCATCTGCAATAATGTGAAGGGG
TGTCCCTTCACTTCTTTCAATGTGCAAGATCCACAGCCTACCAAAACAGCCACCATCAATGCAAGTGCCT
CCCACTCCAGACTAGATGACATTAACCCTACAGTACTAATCAAAAGGCGTTCAACTGAGCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227684 representing NM_011198
Red=Cloning site Green=Tags(s)

MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPT
PNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPP
VADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGL
GHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGL
VPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELY
PALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKG
CPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_011198
ORF Size 1812 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_011198.3, NP_035328
RefSeq Size 4150
RefSeq ORF 1815
Locus ID 19225
Cytogenetics 1 G1|1 63.84 cM
Gene Summary This gene encodes an enzyme that is a member of the prostaglandin G/H synthase family. The encoded protein converts arachidonic acid to prostaglandin endoperoxide H2 which is a key enzymatic step in prostaglandin biosynthesis. This gene is the inducible prostaglandin G/H synthase family member that is upregulated during inflammation. Aberrant regulation of this gene is associated with cancer progression in several tissues and an increased risk of cardiovascular events. This gene is the target of many non-steroidal anti-inflammatory drugs. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)