Fgf23 (NM_022657) Mouse Tagged ORF Clone

CAT#: MG227482

Fgf23 (GFP-tagged) - Mouse fibroblast growth factor 23 (Fgf23), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fgf23 (NM_022657) Mouse Tagged ORF Clone
Symbol Fgf23
Vector pCMV6-AC-GFP
Sequence Data
>MG227482 representing NM_022657
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTAGGGACCTGCCTTAGACTCCTGGTGGGCGCGCTCTGCACTGTCTGCAGCTTGGGCACTGCTAGAG
CCTATCCAGACACTTCCCCATTGCTTGGCTCCAACTGGGGAAGCCTGACCCACCTGTACACGGCTACAGC
CAGGACCAGCTATCACCTACAGATCCATAGGGATGGTCATGTAGATGGCACCCCCCATCAGACCATCTAC
AGTGCCCTGATGATTACATCAGAGGACGCCGGCTCTGTGGTGATAACAGGAGCCATGACTCGAAGGTTCC
TTTGTATGGATCTCCACGGCAACATTTTTGGATCGCTTCACTTCAGCCCAGAGAATTGCAAGTTCCGCCA
GTGGACGCTGGAGAATGGCTATGACGTCTACTTGTCGCAGAAGCATCACTACCTGGTGAGCCTGGGCCGC
GCCAAGCGCATCTTCCAGCCGGGCACCAACCCGCCGCCCTTCTCCCAGTTCCTGGCGCGCAGGAACGAGG
TCCCGCTGCTGCACTTCTACACTGTTCGCCCACGGCGCCACACGCGCAGCGCCGAGGACCCACCCGAGCG
CGACCCACTGAACGTGCTCAAGCCGCGGCCCCGCGCCACGCCTGTGCCTGTATCCTGCTCTCGCGAGCTG
CCGAGCGCAGAGGAAGGTGGCCCCGCAGCCAGCGATCCTCTGGGGGTGCTGCGCAGAGGCCGTGGAGATG
CTCGCGGGGGCGCGGGAGGCGCGGATAGGTGTCGCCCCTTTCCCAGGTTCGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227482 representing NM_022657
Red=Cloning site Green=Tags(s)

MLGTCLRLLVGALCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIY
SALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGR
AKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRSAEDPPERDPLNVLKPRPRATPVPVSCSREL
PSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_022657
ORF Size 753 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022657.3, NP_073148
RefSeq Size 2702
RefSeq ORF 756
Locus ID 64654
Cytogenetics 6|6 F3
Gene Summary This gene encodes a member of the fibroblast growth factor family. The encoded protein regulates phosphate homeostasis and vitamin D metabolism. Mutation of the related gene in humans causes autosomal dominant hypophosphatemic rickets (ADHR). The secreted protein is further cleaved into N- and C-terminal chains, which results in loss of function. [provided by RefSeq, Mar 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)