Fyn (NM_001122893) Mouse Tagged ORF Clone

CAT#: MG227453

Fyn (GFP-tagged) - Mouse Fyn proto-oncogene (Fyn) transcript variant 1, (10ug)

Change vector?

  • TrueORF®

USD 763


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fyn (NM_001122893) Mouse Tagged ORF Clone
Symbol Fyn
Synonyms AI448320; AW552119
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG227453 representing NM_001122893
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGTGTGCAATGTAAGGATAAAGAAGCAGCGAAACTGACAGAGGAGAGGGACGGCAGCCTGAACC
AGAGCTCTGGGTACCGCTATGGCACAGACCCCACCCCTCAGCACTACCCCAGCTTCGGCGTGACCTCCAT
CCCGAACTACAACAACTTCCACGCAGCTGGGGGCCAGGGACTCACCGTCTTTGGGGGTGTGAACTCCTCC
TCTCACACTGGGACCCTACGCACGAGAGGAGGGACAGGAGTGACACTGTTTGTGGCGCTTTATGACTATG
AAGCACGGACGGAAGATGACCTGAGTTTTCACAAAGGAGAAAAATTTCAAATATTGAACAGCTCGGAAGG
AGACTGGTGGGAAGCCCGCTCCTTGACAACCGGGGAAACTGGTTACATTCCCAGCAATTACGTGGCTCCA
GTTGACTCCATCCAGGCAGAAGAGTGGTACTTTGGAAAACTTGGCCGCAAAGATGCTGAGAGACAGCTCC
TGTCCTTTGGAAACCCAAGAGGTACCTTTCTTATCCGCGAGAGCGAAACCACCAAAGGTGCCTACTCACT
TTCCATCCGTGATTGGGATGATATGAAAGGGGACCACGTCAAACATTATAAAATCCGCAAGCTTGACAAT
GGTGGATACTATATCACAACGCGGGCCCAGTTTGAAACACTTCAGCAACTGGTACAGCATTACTCAGAGA
GAGCCGCAGGTCTCTGCTGCCGCCTAGTAGTTCCCTGTCACAAAGGGATGCCAAGGCTTACCGATCTGTC
TGTCAAAACCAAAGATGTCTGGGAAATCCCTCGAGAATCCCTGCAGTTGATCAAGAGACTGGGAAATGGG
CAGTTTGGGGAAGTATGGATGGGTACCTGGAATGGAAATACAAAAGTAGCCATAAAGACCCTTAAGCCAG
GCACCATGTCTCCGGAGTCCTTCCTGGAGGAGGCGCAGATCATGAAGAAGCTGAAGCATGACAAGCTGGT
GCAGCTCTACGCGGTCGTGTCTGAGGAGCCCATTTACATCGTCACGGAGTACATGAGCAAAGGAAGTTTG
CTTGACTTCTTAAAAGATGGTGAAGGAAGAGCTCTGAAGTTGCCAAACCTTGTGGACATGGCGGCACAGG
TTGCTGCAGGAATGGCTTACATCGAGCGCATGAATTATATCCACAGAGATCTGCGATCAGCAAACATTCT
AGTGGGGAATGGACTAATTTGCAAGATTGCTGACTTTGGATTGGCTCGGTTGATTGAAGACAATGAATAC
ACAGCAAGACAAGGTGCGAAGTTTCCCATTAAGTGGACAGCCCCCGAAGCGGCCCTGTATGGAAGGTTCA
CAATCAAGTCTGACGTATGGTCTTTTGGAATCTTACTCACAGAGCTGGTCACCAAAGGAAGAGTGCCATA
CCCAGGCATGAACAACCGGGAGGTGCTGGAGCAGGTGGAGAGAGGCTATAGGATGCCCTGCCCACAGGAC
TGCCCGATCTCCCTGCACGAGCTCATGATCCACTGCTGGAAAAAGGATCCGGAAGAGCGCCCGACCTTCG
AGTACTTGCAGGGCTTCCTGGAGGACTACTTTACGGCCACAGAGCCCCAGTATCAGCCCGGTGAAAACCT
G


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227453 representing NM_001122893
Red=Cloning site Green=Tags(s)

MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS
SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN
GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG
QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSL
LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD
CPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001122893
ORF Size 1611 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001122893.1, NP_001116365
RefSeq Size 3544
RefSeq ORF 1614
Locus ID 14360
Cytogenetics 10 B1|10 20.51 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations