Crebbp (NM_001025432) Mouse Tagged ORF Clone

CAT#: MG227381

Crebbp (GFP-tagged) - Mouse CREB binding protein (Crebbp), (10ug)

Change vector?

  • TrueORF®

USD 4,275


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Crebbp (NM_001025432) Mouse Tagged ORF Clone
Symbol Crebbp
Synonyms AW558298; CBP; CBP/p300; KAT3A; p300/CBP
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG227381 representing NM_001025432
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGAACTTGCTGGACGGACCGCCCAACCCCAAACGAGCCAAACTCAGCTCGCCCGGCTTCTCCG
CGAATGACAACACAGATTTTGGATCATTGTTTGACTTGGAAAATGACCTTCCTGATGAGCTGATCCCCAA
TGGAGAATTAAGCCTTTTAAACAGTGGGAACCTTGTTCCAGATGCTGCGTCCAAACATAAACAACTGTCA
GAGCTTCTTAGAGGAGGCAGCGGCTCTAGCATCAACCCAGGGATAGGCAATGTGAGTGCCAGCAGCCCTG
TGCAACAGGGCCTTGGTGGCCAGGCTCAGGGGCAGCCGAACAGTACAAACATGGCCAGCTTAGGTGCCAT
GGGCAAGAGCCCTCTGAACCAAGGAGACTCATCAACACCCAACCTGCCCAAACAGGCAGCCAGCACCTCT
GGGCCCACTCCCCCTGCCTCCCAAGCACTGAATCCACAAGCACAAAAGCAAGTAGGGCTGGTGACCAGTA
GTCCTGCCACATCACAGACTGGACCTGGGATCTGCATGAATGCTAACTTCAACCAGACCCACCCAGGCCT
TCTCAATAGTAACTCTGGCCATAGCTTAATGAATCAGGCTCAACAAGGGCAAGCTCAAGTCATGAATGGA
TCTCTTGGGGCTGCTGGAAGAGGAAGGGGAGCTGGAATGCCCTACCCTGCTCCAGCCATGCAGGGGGCCA
CAAGCAGTGTGCTGGCGGAGACCTTGACACAGGTTTCCCCACAAATGGCTGGCCATGCTGGACTAAATAC
AGCACAGGCAGGAGGCATGACCAAGATGGGAATGACTGGTACCACAAGTCCATTTGGACAACCCTTTAGT
CAAACTGGAGGGCAGCAGATGGGAGCCACTGGAGTGAACCCCCAGTTAGCCAGCAAACAGAGCATGGTCA
ATAGTTTACCTGCTTTTCCTACAGATATCAAGAATACTTCAGTCACCACTGTGCCAAATATGTCCCAGTT
GCAAACATCAGTGGGAATTGTACCCACACAAGCAATTGCAACAGGCCCCACAGCAGACCCTGAAAAACGC
AAACTGATACAGCAGCAGCTGGTTCTACTGCTTCATGCCCACAAATGTCAGAGACGAGAGCAAGCAAATG
GAGAGGTTCGAGCCTGTTCTCTCCCACACTGTCGAACCATGAAAAACGTTTTGAATCACATGACACATTG
TCAGGCTGGGAAAGCCTGCCAAGTTGCCCATTGTGCATCTTCACGACAAATCATCTCTCATTGGAAGAAC
TGCACACGACATGACTGTCCTGTTTGCCTCCCTTTGAAAAATGCCAGTGACAAGCGAAACCAACAAACCA
TCCTGGGATCTCCAGCTAGTGGAATTCAAAACACAATTGGTTCTGTTGGTGCAGGGCAACAGAATGCCAC
TTCCTTAAGTAACCCAAATCCCATAGACCCCAGTTCCATGCAGCGGGCCTATGCTGCTCTAGGACTCCCC
TACATGAACCAGCCTCAGACGCAGCTGCAGCCTCAGGTTCCTGGCCAGCAACCAGCACAGCCTCCAGCCC
ACCAGCAGATGAGGACTCTCAATGCCCTAGGAAACAACCCCATGAGTATCCCAGCAGGAGGAATAACAAC
AGATCAACAGCCACCAAACTTGATTTCAGAATCAGCTCTTCCAACTTCCTTGGGGGCTACCAATCCACTG
ATGAATGATGGTTCAAACTCTGGTAACATTGGAAGCCTCAGCACGATACCTACAGCAGCGCCTCCTTCCA
GCACTGGTGTTCGAAAAGGCTGGCATGAACATGTGACTCAGGACCTACGGAGTCATCTAGTCCATAAACT
CGTTCAAGCCATCTTCCCAACTCCAGACCCTGCAGCTCTGAAAGATCGCCGCATGGAGAACCTGGTTGCC
TATGCTAAGAAAGTGGAGGGAGACATGTATGAGTCTGCTAATAGCAGGGATGAATACTATCATTTATTAG
CAGAGAAAATCTATAAAATACAAAAAGAACTAGAAGAAAAGCGGAGGTCACGTTTACATAAGCAAGGCAT
CCTGGGTAACCAGCCAGCTTTACCAGCTTCTGGGGCTCAGCCCCCTGTGATTCCACCAGCCCAGTCTGTA
AGACCTCCAAATGGGCCCCTGCCTTTGCCAGTGAATCGCATGCAGGTTTCTCAAGGGATGAATTCATTTA
ACCCAATGTCCCTGGGAAACGTCCAGTTGCCACAGGCACCCATGGGACCTCGTGCAGCCTCCCCTATGAA
CCACTCTGTGCAGATGAACAGCATGGCCTCAGTTCCGGGTATGGCCATTTCTCCTTCACGGATGCCTCAG
CCTCCAAATATGATGGGCACTCATGCCAACAACATTATGGCCCAGGCACCTACTCAGAACCAGTTTCTGC
CACAGAACCAGTTTCCATCATCCAGTGGGGCAATGAGTGTGAACAGTGTGGGCATGGGGCAACCAGCAGC
CCAGGCAGGTGTTTCACAGGGTCAGGTACCTGGAGCTGCTCTCCCTAACCCTCTGAACATGCTGGCACCC
CAGGCCAGCCAGCTGCCTTGCCCACCAGTGACACAGTCACCATTGCACCCGACTCCACCTCCTGCTTCCA
CAGCTGCTGGCATGCCCTCTCTCCAACATCCAACGGCACCAGGAATGACCCCTCCTCAGCCAGCAGCTCC
CACTCAGCCATCTACTCCTGTGTCATCTGGGCAGACTCCTACCCCAACTCCTGGCTCAGTGCCCAGCGCT
GCCCAAACACAGAGTACCCCTACAGTCCAGGCAGCAGCACAGGCTCAGGTGACTCCACAGCCTCAGACCC
CAGTGCAGCCACCATCTGTGGCTACTCCTCAGTCATCACAGCAGCAACCAACGCCTGTGCATACTCAGCC
TCCTGGCACACCGCTTTCTCAGGCAGCAGCCAGCATTGATAATAGAGTCCCTACTCCCTCCTCTGTGACC
AGTGCTGAAACCAGTTCCCAGCAGCCAGGACCCGATGTGCCCATGCTGGAAATGAAGACAGAGGTGCAGA
CAGATGATGCTGAGCCTGAACCTACTGAATCCAAGGGGGAACCTCGGTCTGAGATGATGGAAGAGGATTT
ACAAGGTTCTTCCCAAGTAAAAGAAGAGACAGATACGACAGAGCAGAAGTCAGAGCCAATGGAAGTAGAA
GAAAAGAAACCTGAAGTAAAAGTGGAAGCTAAAGAGGAAGAAGAGAACAGTTCGAACGACACAGCCTCAC
AATCAACATCTCCTTCCCAGCCACGCAAAAAAATCTTTAAACCCGAGGAGCTACGCCAGGCACTTATGCC
AACTCTAGAAGCACTCTATCGACAGGACCCAGAGTCTTTGCCTTTTCGTCAGCCTGTAGATCCTCAGCTC
CTAGGAATCCCAGATTATTTTGATATAGTGAAGAATCCTATGGACCTTTCTACCATCAAACGAAAGCTGG
ACACAGGGCAATATCAAGAACCCTGGCAGTATGTGGATGATGTCTGGCTTATGTTCAACAATGCGTGGCT
ATATAATCGTAAAACGTCCCGTGTATATAAATTTTGCAGTAAACTTGCAGAGGTCTTTGAACAAGAAATT
GACCCTGTCATGCAGTCTCTTGGATATTGCTGTGGACGAAAGTATGAGTTCTCCCCACAGACTTTGTGCT
GTTACGGAAAGCAGCTGTGTACAATTCCTCGTGATGCAGCCTACTACAGCTATCAGAATAGGTATCATTT
CTGTGAGAAGTGTTTCACAGAGATCCAGGGCGAGAATGTGACCCTGGGTGACGACCCTTCCCAACCTCAG
ACGACAATTTCCAAGGATCAATTTGAAAAGAAGAAAAATGATACCTTAGATCCTGAACCTTTTGTTGACT
GCAAAGAGTGTGGCCGGAAGATGCATCAGATTTGTGTTCTACACTATGACATCATTTGGCCTTCAGGTTT
TGTGTGTGACAACTGTTTGAAGAAAACTGGCAGACCTCGGAAAGAAAACAAATTCAGTGCTAAGAGGCTG
CAGACCACACGATTGGGAAACCACTTAGAAGACAGAGTGAATAAGTTTTTGCGGCGCCAGAATCACCCTG
AAGCTGGGGAGGTTTTTGTCAGAGTGGTGGCCAGCTCAGACAAGACTGTGGAGGTCAAGCCGGGAATGAA
GTCAAGGTTTGTGGATTCTGGAGAGATGTCGGAATCTTTCCCATATCGTACCAAAGCACTCTTTGCTTTT
GAGGAGATCGATGGAGTCGATGTGTGCTTTTTTGGGATGCATGTGCAAGAATACGGCTCTGATTGCCCCC
CACCAAATACAAGGCGTGTATACATATCTTATCTGGACAGTATTCATTTCTTCCGGCCCCGCTGCCTCCG
GACAGCTGTTTACCATGAGATCCTCATCGGATATCTCGAGTATGTGAAGAAATTGGGGTATGTGACAGGA
CATATTTGGGCCTGTCCCCCAAGTGAAGGAGATGACTATATCTTTCATTGCCACCCCCCTGACCAGAAAA
TCCCCAAACCAAAACGACTACAGGAGTGGTACAAGAAGATGCTGGACAAGGCGTTTGCAGAGAGGATCAT
TAACGACTATAAGGACATCTTCAAACAAGCGAACGAAGACAGGCTCACGAGTGCCAAGGAGTTGCCCTAT
TTTGAAGGAGATTTCTGGCCTAATGTGTTGGAAGAAAGCATTAAGGAACTAGAACAAGAAGAAGAAGAAA
GGAAAAAAGAAGAGAGTACTGCAGCGAGTGAGACTCCTGAGGGCAGTCAGGGTGACAGCAAAAATGCGAA
GAAAAAGAACAACAAGAAGACCAACAAAAACAAAAGCAGCATTAGCCGCGCCAACAAGAAGAAGCCCAGC
ATGCCCAATGTTTCCAACGACCTGTCGCAGAAGCTGTATGCCACCATGGAGAAGCACAAGGAGGTATTCT
TTGTGATTCATCTGCATGCTGGGCCTGTTATCAGCACTCAGCCCCCCATCGTGGACCCTGATCCTCTGCT
TAGCTGTGACCTCATGGATGGGCGAGATGCCTTCCTCACCCTGGCCAGAGACAAGCACTGGGAATTCTCT
TCCTTACGCCGCTCCAAATGGTCCACTCTGTGCATGCTGGTGGAGCTGCACACACAGGGCCAGGACCGCT
TTGTTTATACCTGCAATGAGTGCAAACACCATGTGGAAACACGCTGGCACTGCACTGTGTGTGAGGACTA
TGACCTTTGTATCAATTGCTACAACACAAAGAGCCACACCCATAAGATGGTGAAGTGGGGGCTAGGCCTA
GATGATGAGGGCAGCAGTCAGGGTGAGCCACAGTCCAAGAGCCCCCAGGAATCCCGGCGTCTCAGCATCC
AGCGCTGCATCCAGTCCCTGGTGCATGCCTGCCAGTGTCGCAATGCCAACTGCTCACTGCCGTCTTGCCA
GAAGATGAAGCGAGTCGTGCAGCACACCAAGGGCTGCAAGCGCAAGACTAATGGAGGATGCCCAGTGTGC
AAGCAGCTCATTGCTCTTTGCTGCTACCACGCCAAACACTGCCAAGAAAATAAATGCCCTGTGCCCTTCT
GCCTCAACATCAAACATAAGCTCCGCCAGCAGCAGATCCAGCATCGCCTGCAGCAGGCTCAGCTCATGCG
CCGGCGAATGGCAACCATGAACACCCGCAATGTGCCTCAGCAGAGTTTGCCTTCTCCTACCTCAGCACCA
CCCGGGACTCCTACACAGCAGCCCAGCACACCCCAAACACCACAGCCCCCAGCCCAGCCTCAGCCTTCAC
CTGTTAACATGTCACCAGCTGGCTTCCCTAATGTAGCCCGGACTCAGCCCCCAACAATAGTGTCTGCTGG
GAAGCCTACCAACCAGGTGCCAGCTCCCCCACCCCCTGCCCAGCCCCCACCTGCAGCAGTAGAAGCAGCC
CGGCAAATTGAACGTGAGGCCCAGCAGCAGCAGCACCTATACCGAGCAAACATCAACAATGGCATGCCCC
CAGGACGTGCAGGTATGGGGACCCCAGGAAGCCAAATGACTCCTGTGGGCCTGAATGTGCCCCGTCCCAA
CCAAGTCAGTGGGCCTGTCATGTCTAGTATGCCACCTGGGCAGTGGCAGCAGGCACCCATCCCTCAGCAG
CAGCCGATGCCAGGCATGCCCAGGCCTGTAATGTCCATGCAGGCCCAGGCAGCAGTGGCTGGGCCACGGA
TGCCCAATGTGCAGCCACCAAGGAGCATCTCGCCAAGTGCCCTGCAAGACCTGCTACGGACCCTAAAGTC
ACCCAGCTCTCCTCAGCAGCAGCAGCAGGTGCTGAACATCCTTAAATCAAACCCACAGCTAATGGCAGCT
TTCATCAAACAGCGCACAGCCAAGTATGTGGCCAATCAGCCTGGCATGCAGCCCCAGCCCGGACTTCAAT
CCCAGCCTGGTATGCAGCCCCAGCCTGGCATGCACCAGCAGCCTAGTTTGCAAAACCTGAACGCAATGCA
AGCTGGTGTGCCACGGCCTGGTGTGCCTCCACCACAACCAGCAATGGGAGGCCTGAATCCCCAGGGACAA
GCTCTGAACATCATGAACCCAGGACACAACCCCAACATGACAAACATGAATCCACAGTACCGAGAAATGG
TGAGGAGACAGCTGCTACAGCACCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAACAAAA
TAGTGCCAGCTTGGCCGGGGGCATGGCGGGACACAGCCAGTTCCAGCAGCCACAAGGACCTGGAGGTTAT
GCCCCAGCCATGCAGCAGCAACGCATGCAACAGCACCTCCCCATCCAGGGCAGCTCCATGGGCCAGATGG
CTGCTCCAATGGGACAACTTGGCCAGATGGGGCAGCCTGGGCTAGGGGCAGACAGCACCCCTAATATCCA
GCAGGCCCTGCAGCAACGGATTCTGCAGCAGCAGCAGATGAAGCAACAAATTGGGTCACCAGGCCAGCCG
AACCCCATGAGCCCCCAGCAGCACATGCTCTCAGGACAGCCACAGGCCTCACATCTCCCTGGCCAGCAGA
TCGCCACATCCCTTAGTAACCAGGTGCGATCTCCAGCCCCTGTGCAGTCTCCACGGCCCCAATCCCAACC
TCCACATTCCAGCCCGTCACCACGGATACAACCCCAGCCTTCACCACACCATGTTTCACCCCAGACTGGT
TCCCCTCACCCTGGACTCGCAGTCACCATGGCCAGCTCCATGGATCAGGGACACCTGGGGAACCCTGAAC
AGAGTGCAATGCTCCCCCAGCTGAATACCCCCAACAGGAGCGCACTGTCCAGTGAACTGTCCCTGGTTGG
TGATACCACGGGAGACACACTAGAAAAGTTTGTGGAGGGTTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227381 representing NM_001025432
Red=Cloning site Green=Tags(s)

MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLS
ELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTS
GPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNG
SLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFS
QTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKR
KLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLP
YMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPL
MNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVA
YAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSV
RPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQ
PPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAP
QASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSA
AQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVT
SAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVE
EKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQL
LGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEI
DPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQ
TTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRL
QTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAF
EEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTG
HIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPY
FEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPS
MPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFS
SLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGL
DDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVC
KQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP
PGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAA
RQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQ
QPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAA
FIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQ
ALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGY
APAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQP
NPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTG
SPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001025432
ORF Size 7323 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001025432.1, NP_001020603
RefSeq Size 7507
RefSeq ORF 7326
Locus ID 12914
Cytogenetics 16 A1|16 2.4 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations