Ctsb (NM_007798) Mouse Tagged ORF Clone

CAT#: MG227342

Ctsb (GFP-tagged) - Mouse cathepsin B (Ctsb), (10ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Ctsb (NM_007798) Mouse Tagged ORF Clone
Symbol Ctsb
Synonyms CB
Vector pCMV6-AC-GFP
Sequence Data
>MG227342 representing NM_007798
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGTGGTCCTTGATCCTTCTTTCTTGCCTGCTGGCACTGACCAGTGCCCATGACAAGCCTTCCTTCC
ACCCGCTGTCGGATGACCTGATTAACTATATCAACAAACAGAATACAACATGGCAGGCTGGACGCAACTT
CTACAATGTTGACATAAGCTATCTGAAGAAGCTGTGTGGCACTGTCCTGGGTGGACCCAAACTGCCAGGA
AGGGTTGCGTTCGGTGAGGACATAGATCTACCTGAAACCTTTGATGCACGGGAACAATGGTCCAACTGCC
CGACCATTGGACAGATTAGAGACCAGGGCTCCTGCGGCTCTTGTTGGGCATTTGGGGCAGTGGAAGCCAT
TTCTGACCGAACCTGCATTCACACCAATGGCCGAGTCAACGTGGAGGTGTCTGCTGAAGACCTGCTTACT
TGCTGTGGTATCCAGTGTGGGGACGGCTGTAATGGTGGCTATCCCTCTGGAGCATGGAGCTTCTGGACAA
AAAAAGGCCTGGTTTCAGGTGGAGTCTACAATTCTCATGTAGGCTGCTTACCATACACCATCCCTCCCTG
CGAGCACCATGTCAATGGCTCCCGTCCCCCATGCACTGGAGAAGGAGATACTCCCAGGTGCAACAAGAGC
TGTGAAGCTGGCTACTCCCCATCCTACAAAGAGGATAAGCACTTTGGGTACACTTCCTACAGCGTGTCTA
ACAGTGTGAAGGAGATCATGGCAGAAATCTACAAAAATGGCCCAGTGGAGGGTGCCTTCACTGTGTTTTC
TGACTTCTTGACTTACAAATCAGGAGTATACAAGCATGAAGCCGGTGATATGATGGGTGGCCACGCCATC
CGCATCCTGGGCTGGGGAGTAGAGAATGGAGTTCCCTACTGGCTGGCAGCCAACTCTTGGAACCTTGACT
GGGGTGATAATGGCTTCTTTAAAATCCTCAGAGGAGAGAACCACTGTGGCATTGAATCAGAAATTGTGGC
TGGAATCCCACGCACTGACCAGTACTGGGGAAGATTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227342 representing NM_007798
Red=Cloning site Green=Tags(s)

MWWSLILLSCLLALTSAHDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPG
RVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLT
CCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKS
CEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAI
RILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007798
ORF Size 1017 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007798.3, NP_031824
RefSeq Size 4756
RefSeq ORF 1020
Locus ID 13030
Cytogenetics 14 D1|14 33.24 cM
Gene Summary This gene encodes a member of the peptidase C1 family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to generate the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. Homozygous knockout mice for this gene exhibit reduced pancreatic damage following induced pancreatitis and reduced hepatocyte apoptosis in a model of liver injury. Pseudogenes of this gene have been identified in the genome. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)