Cacna1a (NM_007578) Mouse Tagged ORF Clone

CAT#: MG227166

Cacna1a (GFP-tagged) - Mouse calcium channel voltage-dependent P/Q type alpha 1A subunit (Cacna1a), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 4,151.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cacna1a (NM_007578) Mouse Tagged ORF Clone
Symbol Cacna1a
Synonyms alpha1A; APCA; BI; Caca1a; Cacnl1a4; Cav2.1; Ccha1a; EA2; FHM; HPCA; la; MHP; MHP1; nmf352;
Vector pCMV6-AC-GFP
Sequence Data
>MG227166 representing NM_007578
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCTTTGGAGACGAGATGCCGGGCCGCTACGGCGCAGGCGGAGGAGGCTCAGGGCCGGCCGCCG
GGGTGGTCGTGGGCGCCGCGGGCGGCCGAGGAGCCGGGGGCAGCCGGCAGGGCGGGCAGCCCGGAGCGCA
GAGGATGTACAAGCAGTCGATGGCGCAGAGAGCGCGGACCATGGCCCTCTACAACCCCATCCCTGTCCGC
CAGAACTGCCTCACGGTCAACCGCTCCCTGTTCCTCTTCAGTGAAGACAACGTGGTGAGAAAATACGCCA
AAAAGATCACTGAATGGCCTCCCTTCGAGTACATGATCCTGGCCACCATCATTGCTAACTGCATCGTCCT
GGCCCTGGAGCAGCACCTCCCTGATGATGACAAGACACCCATGTCTGAGCGGCTGGATGACACGGAACCA
TACTTCATTGGAATCTTCTGTTTTGAGGCTGGAATTAAGATCGTGGCTCTTGGCTTTGCCTTCCACAAAG
GCTCCTACCTGAGGAATGGCTGGAACGTCATGGACTTTGTCGTGGTGCTAACAGGCATCTTGGCCACTGT
CGGGACGGAGTTTGACCTACGGACACTGAGGGCGGTTCGTGTGCTGCGGCCACTCAAGCTGGTGTCTGGA
ATCCCAAGTTTACAAGTCGTCCTGAAGTCAATCATGAAGGCGATGATCCCTCTGCTGCAGATCGGCCTCC
TCCTGTTTTTTGCAATCCTTATTTTTGCAATCATAGGGTTAGAATTTTATATGGGGAAATTTCATACCAC
CTGCTTTGAAGAGGGGACAGACGACATCCAGGGTGAGTCGCCAGCTCCGTGTGGGACAGAGGAGCCTGCC
CGCACCTGCCCCAACGGGACCAAATGTCAGCCGTACTGGGAAGGGCCCAACAACGGCATCACTCAGTTCG
ACAACATCCTGTTTGCTGTGCTCACTGTTTTCCAGTGCATCACCATGGAAGGCTGGACTGATCTCCTCTA
CAATAGCAACGATGCCTCAGGGAACACTTGGAACTGGTTGTACTTCATCCCCCTCATCATCATCGGCTCC
TTTTTTATGCTGAACCTTGTTCTGGGTGTGCTGTCTGGGGAGTTTGCCAAAGAAAGGGAACGTGTGGAGA
ACCGGAGAGCTTTTCTGAAGCTCAGAAGACAACAGCAGATTGAACGTGAGCTCAATGGATACATGGAGTG
GATCTCAAAAGCAGAAGAGGTGATTCTTGCGGAGGACGAGACAGACGTGGAGCAGAGGCACCCTTTTGAT
GGAGCTCTTCGGAGAGCTACTCTGAAGAAAAGCAAGACAGACCTGCTCAACCCTGAGGAGGCCGAGGACC
AGCTGGCTGACATCGCGTCTGTGGGGTCTCCCTTCGCCAGAGCCAGCATCAAAAGTGCCAAGCTGGAGAA
CTCGACTTTTTTTCACAAGAAGGAGAGAAGAATGCGTTTCTACATCCGCCGCATGGTCAAAACTCAGGCC
TTCTACTGGACCGTGCTCAGTCTGGTAGCCCTCAACACGCTGTGCGTCGCCATTGTCCACTACAACCAGC
CCGAGTGGCTCTCCGACTTCCTCTACTATGCAGAATTCATTTTCTTAGGACTCTTTATGTCCGAAATGTT
TATAAAAATGTACGGGCTCGGGACGCGGCCTTACTTCCACTCTTCCTTCAACTGCTTTGACTGTGGGGTC
ATCATTGGGAGCATCTTTGAAGTCATCTGGGCTGTCATCAAACCTGGTACATCCTTTGGAATCAGTGTGT
TACGAGCTCTCAGGTTATTGCGAATTTTCAAAGTCACAAAGTACTGGGCATCTCTCAGAAACCTGGTTGT
CTCCCTCCTCAACTCCATGAAGTCCATCATAAGTCTGTTGTTCCTCCTTTTCCTGTTCATCGTTGTCTTT
GCCCTCCTGGGGATGCAGCTGTTCGGTGGCCAATTTAATTTTGATGAGGGGACTCCGCCCACCAACTTCG
ACACTTTTCCAGCAGCAATAATGACTGTGTTTCAGATCCTGACTGGCGAGGATTGGAATGAGGTCATGTA
TGATGGGATCAAGTCTCAGGGGGGCGTGCAGGGCGGCATGGTGTTCTCCATCTACTTCATCGTCCTCACC
CTCTTCGGGAACTACACCCTGCTGAACGTGTTCTTGGCCATCGCAGTGGACAACCTGGCCAATGCCCAGG
AGCTCACCAAGGATGAGCAAGAAGAGGAAGAGGCAGCCAATCAGAAGCTGGCTCTACAGAAAGCCAAGGA
GGTAGCAGAAGTGAGTCCCCTGTCTGCAGCCAACATGTCCATAGCCGTGAAGGAGCAGCAGAAGAACCAG
AAGCCTACCAAGTCGGTGTGGGAGCAGCGCACCAGCGAGATGCGCAAGCAGAACCTGCTGGCCAGCCGCG
AGGCGCTGTACGGGGACGCGGCTGAGCGCTGGCCCACCCCCTACGCGCGCCCGCTGCGGCCCGACGTGAA
GACTCACTTGGACCGGCCGCTTGTGGTGGACCCGCAGGAGAACCGTAACAACAACACCAACAAGAGCCGT
GCGCCAGAAGCGCTGCGCCCGACCGCGCGGCCCCGCGAAAGCGCGCGCGACCCCGACGCGCGGCGCGCCT
GGCCCGGCAGCCCTGAGCGCGCCCCTGGACGAGAGGGCCCGTATGGGCGCGAGAGCGAGCCTCAGCAGCG
CGAGCACGCGCCGCCCCGCGAGCACGCACCCTGGGACGCGGACACCGAGCGCGCCAAAGCCGGGGACGCG
CCCCGCCGCCACACGCACCGACCTGTGGCGGAGGGCGAGCCTCGCCGCCACCGCGCCCGCCGCCGGCCCG
GGGACGAACCCGACGACAGGCCAGAGCGCAGGCCACGTCCCCGCGACGCCACTAGGCCGGCCCGCGCTGC
AGACGGCGAAGGCGACGATGGGGAGCGCAAGCGGCGACACCGACACGGGCCGCCGGCCCACGACGACAGG
GAGCGCAGACACCGACGCAGAAAAGAGAACCAGGGCTCTGGGGTCCCCGTGTCTGGTCCCAACTTGTCCA
CCACCAGGCCAATCCAGCAGGACCTGGGCCGCCAGGACCTGCCGCTGGCTGAGGATCTTGACAACATGAA
GAATAACAAGCTGGCCACCGGGGAACCTGCCAGTCCCCACGACAGCCTGGGCCACAGCGGCCTTCCCCCC
AGCCCCGCCAAAATCGGGAACAGCACCAACCCTGGTCCCGCCTTGGCCACCAATCCCCAGAACGCTGCCA
GCCGCAGGACGCCCAACAATCCGGGCAACCCGTCCAACCCCGGCCCCCCCAAGACTCCCGAGAACAGCCT
TATCGTCACCAACCCCAGCAGCACCCAGCCCAACTCAGCGAAGACTGCCAGGAAACCCGAGCACATGGCG
GTGGAGATCCCCCCAGCCTGCCCGCCCCTCAACCACACCGTGGTCCAAGTAAACAAAAACGCCAACCCAG
ACCCACTGCCAAAGAAAGAGGAAGAGAAGAAAGAGGAAGAGGAGGCAGACCCCGGGGAGGACGGCCCAAA
GCCCATGCCGCCCTACAGCTCCATGTTCATCCTCTCCACCACCAACCCCCTTCGCCGGCTGTGCCATTAC
ATCCTGAACCTGCGCTACTTCGAGATGTGCATCCTCATGGTCATTGCCATGAGCAGCATCGCTCTGGCCG
CCGAGGACCCGGTGCAGCCCAACGCACCCCGCAACAATGTGCTGCGATATTTTGACTATGTTTTTACAGG
CGTGTTTACCTTTGAGATGGTGATCAAGATGATCGACCTGGGCCTCGTCTTGCATCAGGGGGCCTATTTC
CGTGACCTATGGAACATTCTGGACTTCATAGTGGTCAGTGGGGCCCTGGTGGCCTTTGCCTTCACTGGCA
ATAGCAAAGGAAAGGACATTAACACCATTAAGTCTCTCCGAGTCCTCCGGGTGCTACGACCTCTAAAGAC
CATCAAGCGGCTGCCAAAGCTGAAGGCCGTGTTTGACTGCGTGGTGAACTCGCTCAAGAACGTCTTCAAC
ATCCTCATTGTGTACATGCTGTTCATGTTCATCTTCGCTGTGGTAGCCGTGCAGCTCTTCAAGGGCAAGT
TCTTCCACTGCACGGACGAGTCCAAGGAGTTCGAGAGAGACTGTCGAGGCAAGTACCTCCTGTACGAGAA
GAACGAAGTGAAGGCCCGGGACCGCGAGTGGAAGAAGTACGAGTTCCACTACGACAACGTGCTCTGGGCT
CTGCTCACACTTTTCACAGTGTCCACAGGAGAGGGCTGGCCACAGGTCCTCAAGCACTCAGTGGATGCTA
CTTTTGAGAACCAGGGCCCCAGCCCCGGGTACCGCATGGAGATGTCCATCTTCTACGTGGTGTACTTTGT
AGTGTTTCCCTTCTTCTTTGTCAATATCTTCGTGGCCTTGATCATCATCACCTTTCAGGAGCAGGGAGAC
AAGATGATGGAAGAGTACAGCCTGGAGAAAAATGAGAGGGCCTGCATCGACTTTGCCATCAGTGCCAAGC
CGCTGACCAGGCACATGCCCCAGAACAAGCAGAGCTTCCAGTATCGAATGTGGCAGTTCGTCGTGTCCCC
ACCCTTTGAGTACACCATCATGGCCATGATCGCTCTCAACACCATCGTGCTAATGATGAAGTTCTACGGA
GCCTCGGTGGCCTATGAAAACGCCCTTCGCGTGTTCAACATTGTCTTCACCTCCCTCTTCTCTCTCGAAT
GTGTGCTCAAAGTCATGGCTTTTGGGATTCTGAATTATTTCCGCGATGCCTGGAACATCTTCGACTTTGT
GACTGTTCTGGGCAGCATCACAGACATCCTCGTCACCGAGTTTGGGAATAACTTCATCAACCTGAGCTTT
CTCCGCCTCTTCCGTGCTGCCAGACTCATCAAACTCCTCCGCCAGGGTTACACCATCCGCATTCTCCTCT
GGACTTTCGTGCAGTCCTTCAAGGCCCTACCTTATGTCTGTCTGCTGATCGCCATGCTCTTCTTCATCTA
CGCCATCATCGGGATGCAGGTGTTTGGCAACATCGGCATTGACGGGGAAGACGAGGACAGCGACGAGGAT
GAATTCCAAATCACGGAGCACAATAACTTCCGGACCTTCTTCCAAGCGCTCATGCTTCTCTTCCGGAGCG
CCACAGGAGAAGCGTGGCACAACATCATGCTCTCCTGCCTCAGCGGGAAGCCGTGCGATAAGAACTCTGG
GATCCTCACGGCAGACTGCGGCAACGAGTTCGCGTACTTCTACTTTGTCTCGTTCATCTTCCTGTGCTCG
TTTCTGATGCTGAATCTCTTTGTCGCTGTCATCATGGACAACTTCGAGTACCTCACCCGAGATTCTTCCA
TCCTGGGCCCCCATCACTTGGATGAATACGTGCGTGTCTGGGCAGAGTATGACCCTGCTGCCTGCGGCCG
CATTCACTATAAGGACATGTACAGTTTATTGCGAGTAATATCGCCCCCTCTCGGCTTAGGCAAGAAATGT
CCTCATAGGGTTGCTTGCAAGAGACTCCTGCGGATGGACCTGCCGGTAGCAGATGACAACACAGTTCACT
TCAACTCCACCCTGATGGCTCTGATCCGAACCGCCCTTGATATCAAAATTGCCAAGGGTGGAGCTGACAA
GCAGCAGATGGATGCAGAGCTTCGCAAGGAGATGATGGCCATTTGGCCCAACCTGTCTCAGAAGACCCTG
GATCTGCTGGTCACACCTCACAAGTCCACGGACCTGACAGTGGGTAAGATCTACGCAGCCATGATGATCA
TGGAGTATTACCGGCAGAGCAAGGCCAAGAAACTGCAGGCCATGCGAGAGGAGCAGAACCGGACACCACT
CATGTTCCAGCGCATGGAGCCTCCATCACCAACACAGGAGGGAGGACCCAGCCAGAATGCCCTTCCCTCC
ACTCAGCTGGACCCAGGAGGAGGCCTGATGGCTCACGAAGGCGGCATGAAGGAGAGCCCGTCCTGGGTGA
CCCAGCGGGCCCAAGAGATGTTCCAGAAGACTGGCACCTGGAGCCCAGAGCGAGGGCCACCCATCGACAT
GCCTAACAGCCAGCCCAACTCCCAGTCTGTGGAGATGCGAGAAATGGGTACTGATGGCTACTCAGACAGC
GAACACTACCTCCCCATGGAAGGCCAGACCAGGGCCGCCTCCATGCCCCGCCTCCCAGCAGAGAACCAGA
GGAGAAGGGGCCGGCCACGTGGAAATGACCTCAGTACCATCTCTGATACCAGCCCCATGAAGCGCTCAGC
CTCTGTGCTGGGACCCAAAGCCCGGCGACTGGATGACTACTCACTAGAGCGGGTACCGCCTGAGGAGAAC
CAACGGTACCACCAACGTCGCCGGGACCGTGGCCACCGCACCTCTGAGCGCTCTCTGGGCCGATACACTG
ATGTGGACACAGGTTTGGGGACAGATCTGAGCATGACCACCCAATCGGGTGACCTGCCCTCCAAAGATCG
GGACCAGGACCGGGGCCGACCCAAGGACCGGAAGCATCGGCCACACCACCACCACCACCACCATCATCAT
CATCCCCCGGCCCCCGACCGGGATCGCTACGCACAGGAGCGGCCGGACACCGGCCGGGCGCGGGCCCGGG
AGCAGCGCTGGTCCCGCTCGCCCAGCGAAGGTCGGGAGCACACGACACACAGACAGGGCAGTAGTTCCGT
CAGTGGAAGCCCAGCCCCCTCTACGTCCGGCACCAGCACGCCGCGGCGCGGCCGCCGCCAGCTCCCCCAG
ACCCCCTGCACCCCGCGGCCGCTTGTGTCCTACTCGCCCGCTCCGCGCAGGCCTGCGGCGCGCAGGATGG
CGGGTCCCGCAGCGCCCCCTGGCGGCTCGCCGCGGGGTTGCCGCCGTGCGCCGCGCTGGCCTGCGCATGC
GCCTGAGGGCCCGCGGCCGCGCGGTGCCGACTACACCGAGCCCGACAGCCCGCGCGAGCCGCCAGGGGGC
GCGCACGATCCCGCGCCGCGGTCGCCCAGGACTCCGCGCGCCGCGGGCTGCGCGTCACCGCGCCACGGCC
GCAGGCTGCCCAATGGTTACTACGCGGGGCACGGCGCGCCGCGGCCGCGCACAGCCCGCAGGGGCGCGCA
CGACGCGTACAGCGAGAGCGAGGACGACTGGTGC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227166 representing NM_007578
Red=Cloning site Green=Tags(s)

MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMALYNPIPVR
QNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQHLPDDDKTPMSERLDDTEP
YFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVLTGILATVGTEFDLRTLRAVRVLRPLKLVSG
IPSLQVVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPA
RTCPNGTKCQPYWEGPNNGITQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGS
FFMLNLVLGVLSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GALRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQA
FYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGV
IIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVF
ALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLT
LFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQ
KPTKSVWEQRTSEMRKQNLLASREALYGDAAERWPTPYARPLRPDVKTHLDRPLVVDPQENRNNNTNKSR
APEALRPTARPRESARDPDARRAWPGSPERAPGREGPYGRESEPQQREHAPPREHAPWDADTERAKAGDA
PRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADGEGDDGERKRRHRHGPPAHDDR
ERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDLPLAEDLDNMKNNKLATGEPASPHDSLGHSGLPP
SPAKIGNSTNPGPALATNPQNAASRRTPNNPGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMA
VEIPPACPPLNHTVVQVNKNANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHY
ILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYF
RDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFN
ILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWA
LLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGD
KMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYG
ASVAYENALRVFNIVFTSLFSLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSF
LRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDED
EFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYFYFVSFIFLCS
FLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRVISPPLGLGKKC
PHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTL
DLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPS
TQLDPGGGLMAHEGGMKESPSWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDS
EHYLPMEGQTRAASMPRLPAENQRRRGRPRGNDLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEEN
QRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKHRPHHHHHHHHH
HPPAPDRDRYAQERPDTGRARAREQRWSRSPSEGREHTTHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQ
TPCTPRPLVSYSPAPRRPAARRMAGPAAPPGGSPRGCRRAPRWPAHAPEGPRPRGADYTEPDSPREPPGG
AHDPAPRSPRTPRAAGCASPRHGRRLPNGYYAGHGAPRPRTARRGAHDAYSESEDDWC

SGPTRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007578
ORF Size 7104 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007578.3, NP_031604
RefSeq Size 7929
RefSeq ORF 7107
Locus ID 12286
Cytogenetics 8 C2|8 40.95 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)