Grin2a (NM_008170) Mouse Tagged ORF Clone

CAT#: MG227135

Grin2a (GFP-tagged) - Mouse glutamate receptor ionotropic NMDA2A (epsilon 1) (Grin2a), (10ug)

Change vector?

  • TrueORF®

USD 2,060.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Grin2a (NM_008170) Mouse Tagged ORF Clone
Symbol Grin2a
Synonyms GluN2A; NMDAR2A; NR2A
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG227135 representing NM_008170
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGACTGGGCTACTGGACCTTGCTGGTATTGCCGGCCCTTCTGGTCTGGCACGGTCCGGCGCAGA
ACGCGGCGGCGGAGAAGGGTACTCCAGCGCTGAACATTGCGGTGCTGCTGGGTCACAGCCACGACGTGAC
AGAACGCGAACTTCGAAATCTGTGGGGCCCGGAGCAGGCAACCGGCTTGCCCCTGGATGTGAACGTGGTG
GCGTTATTGATGAACCGCACTGACCCTAAGAGCCTCATCACGCATGTGTGCGACCTCATGTCCGGGGCGC
GCATCCATGGCTTGGTGTTTGGAGATGATACGGACCAAGAGGCTGTGGCTCAGATGCTGGATTTTATCTC
CTCACAGACTTTCATCCCCATCTTGGGCATTCATGGGGGTGCATCTATGATCATGGCTGACAAGGATCCG
ACATCCACGTTCTTCCAGTTTGGAGCTTCCATCCAGCAGCAAGCCACGGTCATGCTGAAGATCATGCAGG
ACTATGACTGGCATGTCTTCTCCTTGGTCACCACCATCTTCCCTGGCTACAGAGACTTCATCAGCTTCAT
CAAGACAACAGTGGACAACAGCTTTGTGGGCTGGGATATGCAGAACGTGATCACACTGGACACCTCTTTT
GAGGACGCCAAGACACAGGTCCAGCTGAAGAAGATCCACTCCTCTGTCATCCTGCTCTACTGCTCCAAGG
ATGAGGCTGTCCTCATCCTGAGCGAGGCTCGCTCTCTTGGCCTCACCGGCTACGATTTCTTCTGGATTGT
CCCCAGTTTGGTCTCCGGGAACACAGAGCTCATCCCCAAAGAGTTTCCATCGGGTCTCATTTCAGTCTCT
TACGACGACTGGGACTACAGTCTGGAGGCAAGAGTGAGAGACGGTCTTGGGATCTTAACCACTGCCGCAT
CTTCCATGTTGGAGAAATTCTCCTACATTCCCGAGGCCAAGGCCAGCTGCTACGGGCAGACAGAGAAGCC
GGAGACCCCGCTACACACTCTGCACCAATTTATGGTCAATGTGACTTGGGATGGCAAGGACTTGTCCTTC
ACTGAGGAAGGCTATCAGGTGCACCCCAGGCTTGTGGTGATCGTGCTGAATAAGGACCGGGAATGGGAAA
AGGTGGGCAAGTGGGAGAATCAGACTCTGAGCCTGCGGCATGCTGTGTGGCCAAGGTATAAGTCCTTTTC
TGACTGTGAGCCAGATGACAACCACCTCAGCATTGTCACCTTGGAGGAAGCCCCCTTCGTCATCGTAGAA
GACATAGACCCACTGACTGAGACCTGCGTCAGGAACACGGTACCCTGTCGGAAGTTTGTCAAGATCAACA
ATTCAACCAACGAAGGGATGAATGTGAAGAAGTGCTGCAAGGGGTTCTGCATCGACATCCTTAAGAAACT
GTCCAGAACTGTAAAGTTCACCTATGACCTCTACCTGGTGACCAATGGGAAGCATGGGAAAAAGGTTAAC
AATGTGTGGAATGGAATGATAGGCGAAGTGGTCTATCAACGAGCAGTTATGGCCGTGGGCTCCCTCACCA
TCAATGAGGAGCGTTCAGAAGTGGTGGACTTCTCCGTGCCCTTTGTGGAGACAGGAATCAGTGTCATGGT
CTCCAGGAGTAATGGCACTGTTTCCCCTTCTGCTTTCCTTGAACCCTTCAGCGCCTCTGTCTGGGTGATG
ATGTTCGTGATGCTGCTCATTGTCTCTGCCATTGCTGTCTTCGTTTTTGAATACTTCAGTCCTGTTGGAT
ACAACAGAAACTTAGCCAAAGGGAAAGCTCCCCATGGGCCTTCTTTTACCATTGGAAAAGCTATATGGCT
CCTCTGGGGCCTGGTCTTCAACAATTCTGTGCCCGTCCAGAATCCTAAAGGCACAACCAGCAAGATAATG
GTATCAGTGTGGGCCTTCTTTGCCGTCATCTTCCTTGCAAGTTACACAGCCAACCTGGCTGCCTTCATGA
TCCAGGAGGAGTTTGTGGACCAAGTGACTGGCCTCAGTGACAAGAAGTTCCAGAGACCTCATGACTATTC
TCCGCCTTTCCGATTTGGGACAGTACCCAATGGAAGTACAGAAAGGAATATTCGTAACAACTACCCCTAT
ATGCACCAGTACATGACCAAATTCAACCAGAGGGGCGTAGAGGATGCCTTGGTCAGCTTGAAAACTGGGA
AGTTGGACGCTTTCATCTATGACGCAGCTGTCTTGAACTACAAGGCCGGGAGGGATGAAGGCTGTAAACT
GGTGACCATTGGGAGCGGGTACATCTTTGCCACCACAGGCTATGGAATTGCTCTGCAGAAGGGCTCACCC
TGGAAGAGGCAGATTGACCTCGCTCTGCTCCAGTTTGTTGGTGACGGTGAGATGGAAGAGCTGGAGACAC
TGTGGCTTACGGGCATCTGCCACAACGAGAAGAATGAGGTGATGAGCAGCCAGCTGGACATCGACAACAT
GGCAGGAGTTTTCTACATGCTGGCTGCAGCTATGGCCCTCAGCCTCATCACCTTCATCTGGGAGCACCTC
TTCTACTGGAAGCTGCGCTTCTGCTTCACAGGCGTGTGTTCTGACCGGCCCGGGCTGCTCTTCTCCATCA
GCAGGGGCATCTACAGTTGCATCCATGGAGTGCACATTGAAGAAAAGAAGAAGTCTCCAGACTTCAATCT
GACTGGGTCACAGAGCAACATGCTAAAGCTTCTCCGCTCAGCTAAAAACATCTCCAACATGTCCAACATG
AACTCCTCGCGAATGGACTCACCCAAAAGAGCTGCTGACTTCATCCAAAGAGGCTCACTTATTGTGGACA
TGGTTTCAGACAAGGGAAATTTGATATACTCAGATAACAGGTCCTTTCAAGGGAAGGACAGTATATTTGG
AGAAAACATGAATGAACTGCAAACATTTGTGGCCAACAGGCACAAGGATAGTCTCAGTAACTATGTGTTT
CAGGGACAGCATCCTCTCACTCTCAATGAGTCCAACCCCAACACAGTGGAGGTGGCTGTCAGCACTGAAT
CCAAAGGGAACTCCCGACCCCGGCAGCTTTGGAAGAAATCCATGGAGTCTCTACGCCAGGATTCTCTAAA
CCAGAACCCAGTCTCCCAGAGGGATGAGAAGACTGCAGAGAATAGGACCCACTCCCTAAAGAGTCCTAGG
TATCTTCCAGAAGAGGTAGCCCATTCTGACATTTCTGAAACCTCAAGCCGGGCCACATGCCACAGGGAGC
CAGATAATAATAAGAACCACAAGACCAAGGATAACTTCAAAAGGTCAATGGCCTCTAAATACCCCAAGGA
CTGTAGTGAGGTTGAACGTACCTACGTGAAAACCAAAGCAAGTTCTCCCAGGGATAAGATCTACACCATC
GATGGTGAGAAGGAGCCCAGCTTCCACTTAGATCCTCCACAGTTCATTGAAAACATAGTCTTGCCTGAGA
ATGTGGACTTCCCAGATACCTACCAAGATCACAATGAGAATTTCCGCAAGGGGGACTCCACACTGCCCAT
GAACAGGAACCCACTACACAATGAAGATGGGCTTCCCAACAATGACCAGTATAAACTCTATGCCAAGCAC
TTTACCTTGAAAGACAAGGGTTCCCCACATAGTGAGGGCAGTGATCGATATCGGCAGAACTCCACGCATT
GCAGAAGCTGCCTCTCAAACCTGCCCACCTACTCAGGCCACTTTACCATGAGATCTCCTTTCAAGTGTGA
TGCCTGTCTGCGGATGGGGAACCTCTATGACATTGATGAAGACCAGATGCTTCAGGAGACAGGCAACCCA
GCTACTCGTGAGGAGGCCTACCAGCAGGACTGGTCACAGAACAACGCCCTCCAGTTCCAGAAGAACAAGC
TAAAGATTAATCGACAGCACTCCTATGATAACATTCTCGACAAACCCAGGGAGATAGACCTTAGCAGGCC
CTCTCGTAGCATAAGCCTCAAGGACAGGGAAAGGCTACTGGAGGGCAACTTATACGGGAGCCTGTTCAGT
GTCCCCTCAAGCAAACTCTTGGGGAACAAAAGCTCCCTTTTCCCCCAAGGTCTGGAGGACAGCAAGAGGA
GCAAATCTCTCTTGCCAGACCATACCTCTGATAATCCTTTCCTCCACACGTACGGGGATGACCAACGCTT
AGTTATTGGGAGATGTCCCTCGGACCCTTACAAACACTCATTGCCATCACAGGCAGTAAATGACAGCTAT
CTTCGGTCATCCTTGAGGTCAACAGCATCATATTGCTCCAGGGACAGTCGGGGCCACAGTGATGTGTATA
TTTCAGAGCATGTTATGCCTTATGCTGCAAATAAGAATAACATGTACTCTACCCCCAGGGTTTTAAATTC
CTGCAGCAATAGACGTGTGTACAAGAAAATGCCTAGTATTGAATCTGATGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227135 representing NM_008170
Red=Cloning site Green=Tags(s)

MGRLGYWTLLVLPALLVWHGPAQNAAAEKGTPALNIAVLLGHSHDVTERELRNLWGPEQATGLPLDVNVV
ALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQTFIPILGIHGGASMIMADKDP
TSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSF
EDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS
YDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASCYGQTEKPETPLHTLHQFMVNVTWDGKDLSF
TEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN
NVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM
MFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM
VSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY
MHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP
WKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNM
NSSRMDSPKRAADFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGENMNELQTFVANRHKDSLSNYVF
QGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESLRQDSLNQNPVSQRDEKTAENRTHSLKSPR
YLPEEVAHSDISETSSRATCHREPDNNKNHKTKDNFKRSMASKYPKDCSEVERTYVKTKASSPRDKIYTI
DGEKEPSFHLDPPQFIENIVLPENVDFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKH
FTLKDKGSPHSEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREEAYQQDWSQNNALQFQKNKLKINRQHSYDNILDKPREIDLSRPSRSISLKDRERLLEGNLYGSLFS
VPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHTYGDDQRLVIGRCPSDPYKHSLPSQAVNDSY
LRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_008170
ORF Size 4392 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_008170.2, NP_032196
RefSeq Size 4512
Locus ID 14811
Cytogenetics 16 A1|16 5.28 cM
Gene Summary NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.