Gata4 (NM_008092) Mouse Tagged ORF Clone

CAT#: MG227022

Gata4 (GFP-tagged) - Mouse GATA binding protein 4 (Gata4), (10ug)

Change vector?

  • TrueORF®

USD 618


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gata4 (NM_008092) Mouse Tagged ORF Clone
Symbol Gata4
Synonyms Gata-4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG227022 representing NM_008092
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCAAAGCCTGGCCATGGCCGCCAACCACGGCCCCCCGCCCGGCGCCTACGAAGCAGGTGGCCCTG
GCGCCTTCATGCACAGCGCGGGCGCCGCGTCCTCGCCCGTCTACGTGCCCACTCCGCGGGTGCCGTCCTC
TGTGCTGGGCCTGTCCTACCTGCAGGGCGGTGGCAGTGCCGCTGCAGCTGGAACCACCTCGGGTGGCAGC
TCCGGGGCCGGCCCGTCGGGTGCGGGGCCTGGGACCCAGCAGGGTAGCCCTGGCTGGAGCCAAGCTGGAG
CCGAGGGAGCCGCCTACACCCCGCCGCCCGTGTCCCCGCGCTTCTCTTTCCCGGGGACTACTGGGTCCCT
GGCGGCCGCTGCCGCCGCTGCCGCAGCCCGGGAAGCTGCAGCCTACGGCAGTGGCGGCGGGGCGGCGGGC
GCTGGTCTGGCTGGCCGAGAGCAGTACGGGCGTCCGGGCTTCGCCGGCTCCTACTCCAGCCCCTACCCAG
CCTACATGGCCGACGTGGGAGCATCCTGGGCCGCAGCCGCTGCCGCCTCTGCCGGCCCCTTCGACAGCCC
AGTCCTGCACAGCCTGCCTGGACGGGCCAACCCTGGAAGACACCCCAATCTCGATATGTTTGATGACTTC
TCAGAAGGCAGAGAGTGTGTCAATTGTGGGGCCATGTCCACCCCACTCTGGAGGCGAGATGGGACGGGAC
ACTACCTGTGCAATGCCTGTGGCCTCTATCACAAGATGAACGGCATCAACCGGCCCCTCATTAAGCCTCA
GCGCCGCCTGTCCGCTTCCCGCCGGGTAGGCCTCTCCTGTGCCAACTGCCAGACTACCACCACCACGCTG
TGGCGTCGTAATGCCGAGGGTGAGCCTGTATGTAATGCCTGCGGCCTCTACATGAAGCTCCATGGGGTTC
CCAGGCCTCTTGCAATGCGGAAGGAGGGGATTCAAACCAGAAAACGGAAGCCCAAGAACCTGAATAAATC
TAAGACGCCAGCAGGTCCTGCTGGTGAGACCCTCCCTCCCTCCAGTGGTGCCTCCAGCGGTAACTCCAGC
AATGCCACTAGCAGCAGCAGCAGCAGTGAAGAGATGCGCCCCATCAAGACAGAGCCCGGGCTGTCATCTC
ACTATGGGCACAGCAGCTCCATGTCCCAGACATTCAGTACTGTGTCCGGCCACGGGCCCTCCATCCATCC
AGTGCTGTCTGCTCTGAAGCTGTCCCCACAAGGCTATGCATCTCCTGTCACTCAGACATCGCAGGCCAGC
TCCAAGCAGGACTCTTGGAACAGCCTGGTCCTGGCTGACAGTCATGGGGACATAATCACCGCG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227022 representing NM_008092
Red=Cloning site Green=Tags(s)

MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSAAAAGTTSGGS
SGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGSGGGAAG
AGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPGRHPNLDMFDDF
SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTL
WRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGETLPPSSGASSGNSS
NATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGPSIHPVLSALKLSPQGYASPVTQTSQAS
SKQDSWNSLVLADSHGDIITA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_008092
ORF Size 1323 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_008092.3, NP_032118
RefSeq Size 3393
RefSeq ORF 1326
Locus ID 14463
Cytogenetics 14 D1|14 33.24 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations