Ptger4 (NM_001136079) Mouse Tagged ORF Clone

CAT#: MG226255

Ptger4 (GFP-tagged) - Mouse prostaglandin E receptor 4 (subtype EP4) (Ptger4) transcript variant 1, (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 691.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ptger4 (NM_001136079) Mouse Tagged ORF Clone
Symbol Ptger4
Synonyms EP4; Ptgerep4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG226255 representing NM_001136079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATCCCCGGAGTCAACGCGTCCTTCTCCTCCACTCCGGAGAGGCTGAACAGCCCGGTGACCATTC
CCGCAGTGATGTTCATCTTCGGGGTGGTGGGCAACCTGGTGGCCATCGTAGTATTGTGCAAGTCGCGCAA
GGAGCAGAAAGAGACGACCTTTTACACTCTAGTATGTGGGCTGGCTGTCACTGACCTTCTGGGCACCTTG
TTGGTAAGCCCGGTGACCATCGCCACATACATGAAGGGCCAGTGGCCCGGAGACCAGGCACTGTGTGACT
ATAGCACCTTCATCCTACTTTTCTTCGGTCTGTCGGGTCTCAGCATCATCTGTGCCATGAGCATCGAGCG
CTACCTGGCCATCAACCACGCCTACTTCTACAGCCACTACGTGGACAAGCGGCTGGCCGGCCTCACACTC
TTCGCCATCTATGCATCTAACGTGCTGTTCTGCGCGCTGCCCAACATGGGCCTGGGCAGATCCGAGCGGC
AGTACCCGGGCACCTGGTGCTTCATCGACTGGACCACCAACGTAACGGCCTACGCCGCCTTCTCTTACAT
GTACGCCGGCTTCAGCTCCTTCCTCATCCTTGCCACCGTGCTCTGCAACGTGCTGGTGTGCGGCGCGCTG
CTCCGCATGCACCGCCAGTTCATGCGCCGCACCTCGTTGGGCACGGAGCAGCACCATGCGGCTGCCGCCG
CCGCGGTAGCTTCGGTGGCCTGTCGGGGCCACGCTGGGGCCTCCCCAGCCCTGCAGCGCCTCAGCGACTT
TCGCCGCCGCAGGAGTTTCCGGCGCATCGCGGGTGCGGAGATCCAGATGGTCATCTTACTCATCGCCACC
TCTCTGGTGGTGCTCATCTGCTCCATTCCGCTCGTGGTGCGAGTGTTCATTAACCAGTTATATCAGCCAA
ACGTGGTGAAAGACATCAGCAGAAACCCAGATTTGCAGGCCATCAGGATTGCTTCTGTGAACCCCATCCT
GGACCCCTGGATTTACATCCTTCTTCGGAAGACTGTGCTCAGTAAAGCCATAGAGAAGATCAAGTGCCTC
TTCTGCCGCATTGGCGGTTCCGGCAGAGACAGCTCGGCCCAGCACTGCTCAGAGAGTCGGAGGACATCTT
CCGCCATGTCCGGCCACTCTCGCTCCTTCCTCGCCCGGGAGTTAAAGGAGATCAGCAGCACGTCCCAGAC
CCTCCTGTACCTGCCAGACCTGACTGAAAGCAGCCTCGGAGGCAGGAATTTGCTTCCAGGTTCGCATGGC
ATGGGCCTGACCCAAGCAGACACCACCTCGCTGAGAACTTTGCGAATTTCCGAGACCTCAGACTCCTCCC
AGGGCCAGGACTCTGAGAGTGTCCTGTTGGTGGATGAGGTTAGTGGGAGCCACAGAGAGGAGCCTGCCTC
TAAAGGAAACTCTCTGCAAGTCACATTCCCCAGTGAAACTCTGAAATTATCTGAAAAATGTATA


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG226255 representing NM_001136079
Red=Cloning site Green=Tags(s)

MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTL
LVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTL
FAIYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGAL
LRMHRQFMRRTSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIAGAEIQMVILLIAT
SLVVLICSIPLVVRVFINQLYQPNVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCL
FCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTSQTLLYLPDLTESSLGGRNLLPGSHG
MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSHREEPASKGNSLQVTFPSETLKLSEKCI

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001136079
ORF Size 1464 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001136079.1, NP_001129551
RefSeq Size 3327
RefSeq ORF 1467
Locus ID 19219
Cytogenetics 15 A1|15 1.99 cM
Gene Summary Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)