Ceacam1 (NM_001039185) Mouse Tagged ORF Clone

CAT#: MG225456

Ceacam1 (GFP-tagged) - Mouse carcinoembryonic antigen-related cell adhesion molecule 1 (Ceacam1) transcript variant 1, (10ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 732.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Ceacam1 (NM_001039185) Mouse Tagged ORF Clone
Symbol Ceacam1
Synonyms bb-1; Bgp; Bgp1; C-CAM; Cc1; CD66a; Cea-1; Cea-7; Cea1; Cea7; Hv-2; Hv2; mCEA1; Mhv-1; MHVR; MHVR1;
Vector pCMV6-AC-GFP
Sequence Data
>MG225456 representing NM_001039185
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGGGAGGACTACTGCTCACAGCCTCAC
TTTTAGCCTCCTGGAGCCCTGCCACCACTGCTGAAGTCACCATTGAGGCTGTGCCGCCCCAGGTTGCTGA
AGACAACAATGTTCTTCTACTTGTTCACAATCTGCCCCTGGCGCTTGGAGCCTTTGCCTGGTACAAGGGA
AACACTACGGCTATAGACAAAGAAATTGCACGATTTGTACCAAATAGTAATATGAATTTCACGGGGCAAG
CATACAGCGGCAGAGAGATAATATACAGCAATGGATCCCTGCTCTTCCAAATGATCACCATGAAGGATAT
GGGAGTCTACACACTAGATATGACAGATGAAAACTATCGTCGTACTCAGGCGACTGTGCGATTTCATGTA
CACCCCATATTATTAAAGCCCAACATCACAAGCAACAACTCCAATCCCGTGGAGGGTGACGACTCCGTAT
CATTAACCTGTGACTCTTACACTGACCCTGATAATATAAACTACCTGTGGAGCAGAAATGGTGAAAGCCT
TTCAGAAGGTGACAGGCTGAAGCTGTCTGAGGGCAACAGGACTCTCACTTTACTCAATGTCACGAGGAAT
GACACAGGACCCTATGTGTGTGAAACCCGGAATCCAGTGAGTGTCAACCGAAGTGACCCATTCAGCCTGA
ACATTATCTATGGTCCGGACACCCCGATTATATCCCCCTCAGATATTTATTTGCATCCAGGGTCAAACCT
CAACCTCTCCTGCCATGCAGCCTCTAACCCACCTGCACAGTACTTTTGGCTTATCAATGAGAAGCCCCAT
GCATCCTCCCAAGAGCTCTTTATCCCCAACATCACTACTAATAATAGCGGAACCTATACCTGCTTCGTCA
ATAACTCTGTCACTGGCCTCAGTAGGACCACAGTCAAGAACATTACAGTCCTTGAGCCAGTGACTCAGCC
CTTCCTCCAAGTCACCAACACCACAGTCAAAGAACTAGACTCTGTGACCCTGACCTGCTTGTCGAATGAC
ATTGGAGCCAACATCCAGTGGCTCTTCAATAGCCAGAGTCTTCAGCTCACAGAGAGAATGACACTCTCCC
AGAACAACAGCATCCTCAGAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCTC
GAATCCAGTCAGCGTCAGGAGGAGCAACTCAATCAAGCTGGACATAATATTTGACCCAACACAAGGAGGC
CTCTCAGATGGCGCCATTGCTGGCATCGTGATTGGAGTTGTGGCTGGGGTGGCTCTAATAGCAGGGCTGG
CATATTTCCTCTATTCCAGGAAGTCTGGCGGGGGAAGTGACCAGCGAGATCTCACAGAGCACAAACCCTC
AGCCTCCAACCACAATCTGGCTCCTTCTGACAACTCTCCTAACAAGGTGGATGACGTCGCATACACTGTC
CTGAACTTCAATTCCCAGCAACCCAACCGGCCAACTTCAGCCCCTTCTTCTCCAAGAGCCACAGAAACAG
TTTATTCAGAAGTAAAAAAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225456 representing NM_001039185
Red=Cloning site Green=Tags(s)

MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKG
NTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHV
HPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRN
DTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPH
ASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELDSVTLTCLSND
IGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGG
LSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTV
LNFNSQQPNRPTSAPSSPRATETVYSEVKKK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001039185
ORF Size 1563 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001039185.1, NP_001034274
RefSeq Size 3736
RefSeq ORF 1566
Locus ID 26365
Cytogenetics 7 A3|7 13.84 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)