Grn (NM_008175) Mouse Tagged ORF Clone

CAT#: MG225358

Grn (GFP-tagged) - Mouse granulin (Grn), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 835.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Grn (NM_008175) Mouse Tagged ORF Clone
Symbol Grn
Synonyms epithelin; Pgrn
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG225358 representing NM_008175
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCCCAGGGAGCCCGGACCCCGACGCAGGCAGACCATGTGGGTCCTGATGAGCTGGCTGGCCTTCG
CGGCAGGGCTGGTAGCCGGAACACAGTGTCCAGATGGGCAGTTCTGCCCTGTTGCCTGCTGCCTTGACCA
GGGAGGAGCCAACTACAGCTGCTGTAACCCTCTTCTGGACACATGGCCTAGAATAACGAGCCATCATCTA
GATGGCTCCTGCCAGACCCATGGCCACTGTCCTGCTGGCTATTCTTGTCTTCTCACTGTGTCTGGGACTT
CCAGCTGCTGCCCGTTCTCTAAGGGTGTGTCTTGTGGTGATGGCTACCACTGCTGCCCCCAGGGCTTCCA
CTGTAGTGCAGATGGGAAATCCTGCTTCCAGATGTCAGATAACCCCTTGGGTGCTGTCCAGTGTCCTGGG
AGCCAGTTTGAATGTCCTGACTCTGCCACCTGCTGCATTATGGTTGATGGTTCGTGGGGATGTTGTCCCA
TGCCCCAGGCCTCTTGCTGTGAAGACAGAGTGCATTGCTGTCCCCATGGGGCCTCCTGTGACCTGGTTCA
CACACGATGCGTTTCACCCACGGGCACCCACACCCTACTAAAGAAGTTCCCTGCACAAAAGACCAACAGG
GCAGTGTCTTTGCCTTTTTCTGTCGTGTGCCCTGATGCTAAGACCCAGTGTCCCGATGATTCTACCTGCT
GTGAGCTACCCACTGGGAAGTATGGCTGCTGTCCAATGCCCAATGCCATCTGCTGTTCCGACCACCTGCA
CTGCTGCCCCCAGGACACTGTATGTGACCTGATCCAGAGTAAGTGCCTATCCAAGAACTACACCACGGAT
CTCCTGACCAAGCTGCCTGGATACCCAGTGAAGGAGGTGAAGTGCGACATGGAGGTGAGCTGCCCTGAAG
GATATACCTGCTGCCGCCTCAACACTGGGGCCTGGGGCTGCTGTCCATTTGCCAAGGCCGTGTGTTGTGA
GGATCACATTCATTGCTGCCCGGCAGGGTTTCAGTGTCACACAGAGAAAGGAACCTGCGAAATGGGTATC
CTCCAAGTACCCTGGATGAAGAAGGTCATAGCCCCCCTCCGCCTGCCAGACCCACAGATCTTGAAGAGTG
ATACACCTTGTGATGACTTCACTAGGTGTCCTACAAACAATACCTGCTGCAAACTCAATTCTGGGGACTG
GGGCTGCTGTCCCATCCCAGAGGCTGTCTGCTGCTCAGACAACCAGCATTGCTGCCCTCAGGGCTTCACA
TGTCTGGCTCAGGGGTACTGTCAGAAGGGAGACACAATGGTGGCTGGCCTGGAGAAGATACCTGCCCGCC
AGACAACCCCGCTCCAAATTGGAGATATCGGTTGTGACCAGCATACCAGCTGCCCAGTAGGGCAAACCTG
CTGCCCAAGCCTCAAGGGAAGTTGGGCCTGCTGCCAGCTGCCCCATGCTGTGTGCTGTGAGGACCGGCAG
CACTGTTGCCCGGCCGGGTACACCTGCAATGTGAAGGCGAGGACCTGTGAGAAGGATGTCGATTTTATCC
AGCCTCCCGTGCTCCTGACCCTCGGCCCTAAGGTTGGGAATGTGGAGTGTGGAGAAGGGCATTTCTGCCA
TGATAACCAGACCTGTTGTAAAGACAGTGCAGGAGTCTGGGCCTGCTGTCCCTACCTAAAGGGTGTCTGC
TGTAGAGATGGACGTCACTGTTGCCCCGGTGGCTTCCACTGTTCAGCCAGGGGAACCAAGTGTTTGCGAA
AGAAGATTCCTCGCTGGGACATGTTTTTGAGGGATCCGGTCCCAAGACCGCTACTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG225358 representing NM_008175
Red=Cloning site Green=Tags(s)

MPPREPGPRRRQTMWVLMSWLAFAAGLVAGTQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPRITSHHL
DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPG
SQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNR
AVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTD
LLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGI
LQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFT
CLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQ
HCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVC
CRDGRHCCPGGFHCSARGTKCLRKKIPRWDMFLRDPVPRPLL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_008175
ORF Size 1806 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_008175.4, NP_032201
RefSeq Size 2348
RefSeq ORF 1809
Locus ID 14824
Cytogenetics 11 D|11 66.29 cM
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)