Col1a2 (NM_007743) Mouse Tagged ORF Clone

CAT#: MG225252

Col1a2 (GFP-tagged) - Mouse collagen type I alpha 2 (Col1a2), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,927.00


Availability*
6 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Col1a2 (NM_007743) Mouse Tagged ORF Clone
Symbol Col1a2
Synonyms AA960264; AI325291; Col1a-2; Cola-2; Cola2; oim
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG225252 representing NM_007743
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCAGCTTTGTGGATACGCGGACTCTGTTGCTGCTTGCAGTAACTTCGTGCCTAGCAACATGCCAAT
ATTTGCAATCGGGATCAGTACGAAAGGGCCCCACTGGAGACAGAGGACCACGTGGACAAAGGGGTCCCGC
AGGTCCCCGAGGCAGAGATGGTGTTGATGGTCCCATGGGCCCTCCTGGTCCCCCTGGCTCCCCTGGTCCT
CCCGGCTCCCCTGCCCCCCCTGGTCTTACTGGGAACTTTGCTGCTCAGTATTCTGACAAAGGAGTTTCAT
CTGGCCCTGGACCAATGGGTTTAATGGGACCCAGAGGCCCTCCTGGTGCTGTTGGAGCCCCTGGCCCTCA
AGGTTTCCAAGGACCTGCTGGTGAACCTGGTGAGCCTGGTCAAACGGGTCCTGCAGGTCCCCGTGGTCCA
GCTGGCTCTCCTGGCAAGGCTGGTGAGGATGGTCACCCTGGAAAACCCGGAAGACCTGGGGAGAGAGGAG
TCGTTGGACCACAGGGTGCTCGTGGTTTCCCCGGGACTCCTGGACTTCCTGGCTTCAAAGGCGTGAAAGG
ACACAGTGGTATGGATGGATTAAAGGGACAGCCTGGTGCACAGGGTGTGAAGGGTGAACCCGGTGCCCCT
GGAGAGAATGGAACTCCAGGTCAAGCAGGAGCCCGAGGGCTTCCTGGTGAGAGAGGGCGTGTCGGAGCTC
CTGGTCCAGCTGGTGCCCGAGGCAGTGATGGAAGCGTTGGCCCCGTCGGCCCTGCTGGTCCCATTGGGTC
TGCTGGACCCCCTGGTTTCCCAGGTGCTCCTGGTCCCAAGGGTGAACTTGGGCCCGTTGGTAACCCTGGC
CCTGCTGGTCCTGCTGGTCCCCGTGGTGAAGTGGGTCTTCCAGGTCTTTCTGGCCCTGTTGGACCTCCTG
GCAACCCTGGAACAAATGGGCTCACTGGCGCCAAGGGTGCTACTGGACTCCCTGGTGTCGCTGGGGCTCC
CGGTCTCCCTGGCCCCCGTGGTATTCCTGGCCCCGCTGGTGCTGCTGGTGCTACAGGTGCCAGAGGACTT
GTTGGTGAGCCTGGTCCTGCTGGCTCCAAAGGAGAATCCGGTAACAAGGGTGAGCCTGGCTCTGTTGGAG
CCCAAGGTCCTCCTGGTCCCAGCGGTGAAGAAGGAAAGAGAGGGTCTCCCGGAGAAGCTGGATCTGCTGG
CCCTGCAGGGCCTCCAGGGCTTAGAGGCAGCCCTGGTTCTCGAGGTCTTCCTGGAGCTGATGGCAGAGCT
GGTGTAATGGGTCCTCCTGGCAATCGTGGTTCAACCGGCCCTGCTGGAATCCGAGGTCCTAATGGAGATG
CCGGTCGACCTGGGGAACCTGGTCTCATGGGACCCAGAGGTCTTCCTGGGTCTCCTGGAAATGTTGGCCC
ATCTGGTAAAGAAGGCCCTGTGGGTCTCCCTGGCATTGATGGCAGACCTGGCCCAATCGGCCCAGCTGGA
CCAAGAGGTGAAGCTGGCAACATTGGATTCCCTGGACCCAAAGGCCCCTCTGGTGATCCTGGCAAACCTG
GTGAGAGAGGACACCCCGGTCTTGCTGGTGCTCGGGGAGCTCCAGGACCCGATGGCAACAATGGAGCTCA
GGGCCCCCCTGGACCCCAGGGTGTTCAAGGTGGCAAAGGTGAACAAGGCCCTGCTGGTCCTCCTGGCTTC
CAGGGTCTCCCTGGTCCCTCAGGTACTACTGGAGAAGTTGGCAAGCCCGGAGAAAGGGGTCTTCCTGGTG
AATTCGGTCTCCCTGGTCCTGCTGGTCCAAGAGGAGAACGTGGTACCCCGGGTGAGAGTGGAGCTGCTGG
CCCTTCTGGTCCTATTGGAAGCCGAGGTCCCAGTGGAGCCCCAGGGCCTGATGGAAACAAGGGTGAAGCT
GGTGCAGTCGGTGCTCCAGGCAGTGCTGGTGCCTCTGGGCCTGGTGGGCTTCCAGGAGAGAGGGGTGCTG
CTGGCATACCTGGGGGCAAAGGAGAAAAGGGTGAAACTGGTCTCCGAGGTGACACTGGCAACACTGGTAG
AGATGGTGCTCGTGGCATTCCTGGTGCTGTAGGTGCCCCTGGTCCTGCTGGGGCCTCAGGTGACCGGGGT
GAAGCTGGTGCTGCCGGTCCTTCTGGCCCAGCTGGTCCTCGGGGTAGCCCTGGTGAACGTGGTGAAGTTG
GCCCTGCTGGCCCCAATGGATTTGCTGGTCCTGCTGGTGCTGCTGGCCAACCCGGTGCTAAAGGAGAGAA
GGGAACCAAAGGGCCTAAGGGTGAAAATGGCATTGTTGGTCCAACCGGGTCTGTTGGAGCTGCTGGCCCA
TCTGGTCCTAATGGCCCACCTGGTCCTGTTGGAAGTCGTGGTGATGGAGGGCCCCCTGGTATGACTGGCT
TCCCTGGTGCTGCTGGACGGACTGGTCCCCCCGGACCCAGTGGTATTGCTGGCCCCCCTGGCCCCCCTGG
TGCTGCTGGAAAGGAAGGGATTCGTGGTCCCCGTGGCGACCAAGGTCCAGTTGGCCGAACTGGAGAAACA
GGTGCATCTGGACCCCCTGGATTTGTTGGTGAAAAGGGTCCCTCTGGAGAACCTGGTACCGCAGGAGCCC
CTGGTACCGCAGGTCCTCAGGGTCTTCTTGGTGCTCCCGGTATTCTGGGTCTCCCTGGCTCTAGAGGTGA
ACGTGGTCTGCCAGGTATTGCTGGTGCTCTGGGTGAACCTGGTCCTCTGGGCATCTCAGGCCCTCCTGGT
GCCCGTGGTCCCCCTGGTGCTGTGGGCAGCCCTGGAGTTAATGGTGCCCCTGGTGAAGCTGGTCGTGATG
GTAACCCTGGCAGCGATGGTCCCCCAGGTCGTGATGGTCAGCCTGGACACAAGGGAGAGCGTGGTTACCC
TGGCAGCATTGGTCCGACTGGTGCTGCAGGTGCCCCTGGTCCTCACGGTTCTGTGGGTCCTGCTGGGAAA
CATGGAAACCGAGGTGAACCTGGTCCTGCCGGTTCTGTTGGTCCTGTTGGTGCTGTTGGTCCAAGAGGTC
CTAGTGGTCCTCAAGGCATCCGAGGTGACAAAGGAGAACCTGGTGATAAAGGGCACAGGGGTCTTCCTGG
CTTAAAAGGATACAGTGGATTGCAGGGTCTTCCTGGTCTTGCTGGCCTACATGGTGACCAAGGAGCTCCT
GGTCCTGTGGGTCCTGCTGGTCCCAGGGGTCCTGCTGGGCCTTCTGGACCCGTTGGCAAAGATGGTAGAT
CTGGGCAACCTGGCCCAGTCGGGCCTGCTGGTGTTCGTGGTTCTCAGGGTAGCCAAGGTCCCGCTGGTCC
CCCTGGTCCCCCTGGACCTCCTGGTCCTCCTGGTGTCAGCGGAGGTGGCTATGACTTTGGTTTTGAAGGA
GACTTCTACAGGGCTGACCAGCCTCGCTCCCAGCCTTCACTCAGACCCAAGGACTATGAAGTTGATGCAA
CTCTGAAATCTCTCAATAACCAGATTGAGACCCTTCTCACTCCTGAAGGCTCTAGAAAGAACCCTGCTCG
CACGTGCCGGGACTTAAGACTCAGCCACCCAGAGTGGAACAGCGATTACTACTGGATTGACCCTAACCAA
GGATGTACTATGGATGCCATCAAAGTGTACTGTGATTTCTCTACTGGTGAAACCTGCATCCAGGCCCAAC
CTGTAAACACCCCAGCGAAGAACTCATACAGCCGCGCCCAGGCCAACAAGCATGTCTGGTTAGGAGAGAC
TATCAATGGTGGCAGCCAGTTTGAATACAACGTAGAAGGGGTGTCCTCCAAGGAAATGGCAACTCAGCTC
GCCTTCATGCGCCTGCTAGCCAACCGTGCTTCTCAGAACATCACCTACCACTGCAAGAACAGCATTGCGT
ACCTGGATGAGGAGACGGGCAGCTTGAACAAGGCTGTGCTTCTGCAGGGTTCCAACGATGTTGAACTTGT
TGCTGAGGGCAACAGCAGGTTCACCTACTCTGTCCTAGTCGATGGCTGCTCCAAAAAGACAAATGAATGG
GGCAAGACAATCATTGAATACAAAACAAATAAGCCATCTCGCCTGCCGTTCCTTGACATTGCACCTCTGG
ACATTGGTGGTGCTGACCAAGAATTCCGTGTGGAGGTTGGCCCCGTCTGTTTCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG225252 representing NM_007743
Red=Cloning site Green=Tags(s)

MLSFVDTRTLLLLAVTSCLATCQYLQSGSVRKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGP
PGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGP
AGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAP
GENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPG
PAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGL
VGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRA
GVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAG
PRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF
QGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEA
GAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRG
EAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGP
SGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGET
GASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPG
ARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGK
HGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAP
GPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEG
DFYRADQPRSQPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQ
GCTMDAIKVYCDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQL
AFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEW
GKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCFK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007743
ORF Size 4116 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007743.2, NP_031769
RefSeq Size 5143
RefSeq ORF 4119
Locus ID 12843
Cytogenetics 6 A1|6 1.81 cM
Gene Summary This gene encodes the alpha-2 subunit of the fibril-forming type I collagen, the most abundant protein of bone, skin and tendon extracellular matrices. The encoded protein, in association with alpha-1 subunit, forms heterotrimeric type I procollagen that undergoes proteolytic processing during fibril formation. Mice harboring certain mutations in the encoded gene exhibit symptoms of moderate to severe forms of osteogenesis imperfecta. [provided by RefSeq, Dec 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)