Col6a1 (NM_009933) Mouse Tagged ORF Clone

CAT#: MG223027

Col6a1 (GFP-tagged) - Mouse collagen type VI alpha 1 (Col6a1), (10ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 1,432.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Col6a1 (NM_009933) Mouse Tagged ORF Clone
Symbol Col6a1
Synonyms AI747156; Col6a-1
Vector pCMV6-AC-GFP
Sequence Data
>MG223027 representing NM_009933
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCTGGCCCACGCTCTGCTGCCCCTGCTGCTACAAGCCTGCTGGGTGGCCACACAGGACATCCAGG
GCTCCAAAGCGATTGCCTTCCAAGACTGCCCTGTGGATCTATTCTTCGTGCTCGACACCTCGGAGAGTGT
GGCCTTGAGGCTGAAACCTTATGGGGCCTTGGTGGACAAGGTGAAGTCCTTCACTAAGCGCTTCATTGAC
AACCTGAGAGACAGGTACTACCGGTGTGACCGCAACCTGGTTTGGAATGCGGGTGCGCTGCACTACAGTG
ACGAGGTGGAGATCATCCGAGGGCTCACGCGCATGCCCAGTGGCCGCGATGAGCTCAAGGCCAGCGTGGA
TGCGGTCAAGTACTTCGGGAAAGGCACCTACACCGACTGCGCCATTAAGAAGGGGCTGGAGGAGCTGCTC
ATAGGGGGCTCCCACCTGAAGGAGAACAAGTACTTGATCGTGGTGACCGACGGGCATCCTCTAGAGGGCT
ACAAGGAACCATGCGGGGGTCTGGAAGATGCAGTAAATGAGGCCAAACACCTGGGCATCAAGGTCTTTTC
TGTGGCCATCACACCTGACCACCTGGAGCCACGTCTAAGTATCATTGCCACAGACCACACATACCGGCGC
AATTTCACGGCAGCTGACTGGGGGCATAGCCGCGATGCAGAAGAGGTCATCAGCCAGACCATTGACACCA
TTGTGGACATGATTAAAAATAACGTGGAACAAGTGTGTTGTTCTTTTGAGTGCCAGGCTGCCAGAGGACC
TCCAGGGCCCCGAGGCGACCCTGGGTATGAGGGGGAGCGAGGAAAGCCAGGTCTTCCGGGAGAGAAGGGA
GAAGCTGGAGACCCTGGACGACCTGGGGATCTTGGACCAGTCGGGTACCAGGGTATGAAGGGAGAAAAGG
GGAGCCGTGGAGAGAAGGGTTCCAGAGGACCGAAAGGTTACAAGGGCGAGAAAGGCAAGCGCGGAATCGA
CGGGGTCGACGGCATGAAGGGAGAGACGGGGTACCCAGGACTACCGGGCTGCAAGGGCTCCCCAGGATTT
GATGGCATTCAAGGACCCCCGGGTCCCAAGGGTGATGCTGGTGCCTTTGGGATGAAGGGAGAAAAGGGTG
AAGCTGGAGCAGACGGTGAGGCTGGGAGACCAGGGAACTCAGGGTCACCTGGAGATGAGGGTGATCCTGG
AGAGCCTGGTCCCCCCGGAGAAAAAGGAGAGGCCGGTGATGAAGGAAATGCTGGCCCAGACGGTGCCCCT
GGAGAGAGGGGTGGCCCTGGTGAAAGAGGACCTCGGGGGACCCCTGGTGTGAGAGGACCAAGGGGAGACC
CGGGTGAAGCTGGACCACAGGGTGACCAAGGAAGAGAGGGGCCCGTCGGCATCCCTGGAGACTCGGGTGA
GGCTGGCCCCATTGGACCTAAAGGATACCGAGGTGATGAGGGTCCTCCAGGTCCTGAGGGCCTCAGAGGA
GCCCCAGGACCTGTTGGTCCTCCTGGAGACCCCGGACTGATGGGTGAGAGAGGTGAGGATGGACCACCAG
GAAACGGCACGGAAGGTTTCCCCGGCTTCCCTGGGTATCCAGGCAACAGAGGCCCTCCTGGGCTAAATGG
CACAAAAGGCTACCCTGGCCTCAAGGGGGATGAGGGTGAAGTGGGAGACCCAGGAGAGGATAACAACGAC
ATTTCACCCCGTGGGGTCAAAGGGGCAAAGGGATACCGAGGCCCAGAAGGACCCCAGGGACCTCCAGGAC
ATGTGGGACCACCTGGGCCAGATGAGTGTGAGATCCTGGATATCATCATGAAAATGTGCTCCTGCTGTGA
GTGCACATGTGGACCCATTGACATCCTCTTCGTGCTGGACAGCTCGGAGAGCATTGGCCTACAGAACTTT
GAGATTGCCAAGGACTTCATCATCAAGGTCATTGACCGGTTGAGCAAGGATGAGCTGGTCAAATTTGAGC
CAGGGCAGTCTCACGCGGGCGTGGTACAGTACAGCCACAACCAGATGCAAGAGCACGTGGACATGCGGAG
CCCCAACGTCCGCAACGCCCAGGACTTCAAAGAAGCTGTCAAGAAGCTACAATGGATGGCTGGTGGCACA
TTCACCGGAGAAGCGCTGCAGTACACCCGGGACCGGCTACTCCCACCCACACAGAACAACCGAATTGCCC
TGGTCATTACGGATGGACGTTCTGACACTCAACGGGACACGACACCTCTCAGTGTGCTCTGTGGTGCAGA
CATTCAGGTAGTTTCTGTGGGAATCAAGGATGTGTTTGGCTTTGTGGCGGGCTCCGACCAGCTCAATGTC
ATTTCCTGCCAAGGCTTATCGCAAGGTCGGCCAGGTATCTCCCTGGTGAAGGAGAACTATGCAGAGCTTC
TCGATGACGGCTTTCTGAAGAACATAACAGCCCAGATCTGTATAGATAAGAAGTGTCCGGATTATACCTG
TCCAATCACATTCTCCTCCCCGGCTGACATCACCATCCTGCTAGACAGCTCAGCCAGTGTCGGCAGCCAC
AACTTCGAAACCACCAAGGTCTTCGCCAAGCGCCTAGCTGAGCGATTCCTGTCAGCAGGCAGGGCGGATC
CTTCCCAGGATGTGCGGGTGGCCGTGGTACAGTATAGTGGCCAGGGGCAGCAACAGCCAGGTCGGGCGGC
TCTTCAGTTCTTACAGAATTACACAGTGCTGGCCAGCTCTGTGGACAGCATGGATTTCATCAACGACGCC
ACAGACGTCAACGATGCTCTGAGCTACGTGACTCGTTTCTACCGGGAAGCCTCGTCAGGTGCCACCAAGA
AGAGAGTGCTGTTGTTTTCAGACGGCAACTCTCAGGGGGCCACAGCAGAGGCCATTGAGAAGGCTGTGCA
GGAGGCCCAGCGTGCAGGCATTGAGATCTTTGTGGTGGTGGTGGGACCCCAGGTGAACGAGCCCCACATC
CGTGTGCTTGTCACTGGCAAGACTGCAGAGTACGACGTGGCCTTTGGCGAGCGCCACCTATTCCGTGTAC
CAAACTACCAGGCCCTGCTACGTGGCGTACTCTACCAGACAGTCTCCAGGAAGGTGGCACTGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG223027 representing NM_009933
Red=Cloning site Green=Tags(s)

MRLAHALLPLLLQACWVATQDIQGSKAIAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFID
NLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKASVDAVKYFGKGTYTDCAIKKGLEELL
IGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGIKVFSVAITPDHLEPRLSIIATDHTYRR
NFTAADWGHSRDAEEVISQTIDTIVDMIKNNVEQVCCSFECQAARGPPGPRGDPGYEGERGKPGLPGEKG
EAGDPGRPGDLGPVGYQGMKGEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGMKGETGYPGLPGCKGSPGF
DGIQGPPGPKGDAGAFGMKGEKGEAGADGEAGRPGNSGSPGDEGDPGEPGPPGEKGEAGDEGNAGPDGAP
GERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDSGEAGPIGPKGYRGDEGPPGPEGLRG
APGPVGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGNRGPPGLNGTKGYPGLKGDEGEVGDPGEDNND
ISPRGVKGAKGYRGPEGPQGPPGHVGPPGPDECEILDIIMKMCSCCECTCGPIDILFVLDSSESIGLQNF
EIAKDFIIKVIDRLSKDELVKFEPGQSHAGVVQYSHNQMQEHVDMRSPNVRNAQDFKEAVKKLQWMAGGT
FTGEALQYTRDRLLPPTQNNRIALVITDGRSDTQRDTTPLSVLCGADIQVVSVGIKDVFGFVAGSDQLNV
ISCQGLSQGRPGISLVKENYAELLDDGFLKNITAQICIDKKCPDYTCPITFSSPADITILLDSSASVGSH
NFETTKVFAKRLAERFLSAGRADPSQDVRVAVVQYSGQGQQQPGRAALQFLQNYTVLASSVDSMDFINDA
TDVNDALSYVTRFYREASSGATKKRVLLFSDGNSQGATAEAIEKAVQEAQRAGIEIFVVVVGPQVNEPHI
RVLVTGKTAEYDVAFGERHLFRVPNYQALLRGVLYQTVSRKVALG

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_009933
ORF Size 3075 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009933.4, NP_034063
RefSeq Size 3990
RefSeq ORF 3078
Locus ID 12833
Cytogenetics 10 C1|10 39.71 cM
Gene Summary Collagen VI acts as a cell-binding protein. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)