Glp1r (NM_021332) Mouse Tagged ORF Clone

CAT#: MG222965

Glp1r (GFP-tagged) - Mouse glucagon-like peptide 1 receptor (Glp1r), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 660.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Glp1r (NM_021332) Mouse Tagged ORF Clone
Symbol Glp1r
Synonyms GLP-1R; GLP1Rc
Vector pCMV6-AC-GFP
Sequence Data
>MG222965 representing NM_021332
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGCACCCCAAGCCTCCTGCGCCTGGCGCTCCTGCTGCTCGGGGCGGTGGGCAGGGCCGGCCCCC
GCCCTCAGGGTACCACGGTGTCCCTCTCAGAGACGGTGCAGAAATGGAGAGAATACCGGCGGCAGTGCCA
GCATTTCCTCACGGAAGCGCCACTCCTGGCCACAGGCCTCTTCTGCAACCGGACCTTTGATGACTATGCC
TGCTGGCCGGATGGGCCCCCAGGTTCCTTCGTGAATGTCAGCTGCCCCTGGTACCTGCCCTGGGCCAGTA
GTGTGCTACAAGGCCATGTGTACCGGTTCTGCACAGCTGAGGGTCTCTGGCTACATAAGGACAACTCCAG
CCTGCCCTGGAGGGACCTGTCGGAGTGTGAAGAGTCTAAGCGAGGGGAGAGAAACTTTCCTGAGGAACAG
CTCCTGTCCCTGTACATTATCTACACAGTGGGGTACGCACTTTCTTTCTCCGCCTTGGTCATCGCTTCAG
CCATCCTTGTTGGCTTCAGACACTTGCACTGCACCAGGAACTACATCCACCTGAACCTGTTTGCATCCTT
CATCCTCCGAGCACTGTCCGTCTTCATCAAAGATGCTGCCCTCAAGTGGATGTATAGCACGGCTGCCCAG
CAACACCAGTGGGATGGGCTCCTCTCCTATCAGGACTCTCTAGGCTGCCGACTGGTGTTCCTGCTCATGC
AGTACTGCGTGGCAGCCAACTACTACTGGTTGCTGGTGGAAGGCGTGTATCTATACACACTGCTGGCCTT
CTCGGTGTTCTCGGAGCAGCGCATCTTCAAGCTGTATCTGAGCATAGGCTGGGGAGTTCCGCTGCTGTTC
GTTATCCCATGGGGGATTGTCAAGTATCTCTATGAGGACGAGGGCTGCTGGACTAGGAACTCCAATATGA
ACTACTGGCTCATCATCCGATTGCCCATTCTCTTTGCTATCGGCGTCAACTTTCTTATCTTCATCCGTGT
CATCTGCATAGTGGTCTCCAAACTGAAGGCTAATCTCATGTGCAAGACTGACATCAAATGCAGGCTTGCC
AAGTCCACTCTGACTCTCATCCCCCTTCTGGGGACACATGAAGTCATCTTTGCCTTTGTGATGGACGAAC
ACGCCCGAGGAACCCTACGCTTCATCAAGCTGTTCACAGAACTCTCCTTCACTTCCTTCCAGGGCTTGAT
GGTGGCTATCCTGTACTGCTTTGTCAACAATGAGAAGGTCCAGATGGAGTTTCGGAAATGCTGGGAGCGC
TGGAGGCTGGAGCACTTGAATATCCAGAGAGACTGCAGCATGAAGCCCCTCAAGTGTCCCACCAGCAGCG
TCAGCAGTGGGGCCACAGTGGGCAGCAGCGTGTACGCAGCCACCTGCCAGAGTTCCTACAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG222965 representing NM_021332
Red=Cloning site Green=Tags(s)

MASTPSLLRLALLLLGAVGRAGPRPQGTTVSLSETVQKWREYRRQCQHFLTEAPLLATGLFCNRTFDDYA
CWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQ
LLSLYIIYTVGYALSFSALVIASAILVGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQ
QHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLF
VIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKANLMCKTDIKCRLA
KSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEKVQMEFRKCWER
WRLEHLNIQRDCSMKPLKCPTSSVSSGATVGSSVYAATCQSSYS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_021332
ORF Size 1392 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021332.2, NP_067307
RefSeq Size 1480
RefSeq ORF 1392
Locus ID 14652
Cytogenetics 17 A3.3|17 15.8 cM
Gene Summary This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)