Eng (NM_001146350) Mouse Tagged ORF Clone

CAT#: MG222690

Reviews ()
Write a review
  • TrueORF®

Eng (tGFP-tagged) - Mouse endoglin (Eng) transcript variant 2, (10ug)



Reconstitution Protocol

USD 797.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Eng
Synonyms AI528660; AI662476; CD105; Endo; S-endoglin
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG222690 representing NM_001146350
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCGTGGCGTGCTCCCTCTGCCCATTACCCTGCTGTTTGTCATCTATAGCTTTGTACCCACAACAG
GTCTCGCAGAAAGAGTCGGCTGTGATCTACAGCCTGTGGACCCCACAAGGGGTGAGGTGACGTTTACCAC
CAGCCAGGTCTCCGAGGGCTGTGTAGCTCAGGCTGCCAATGCTGTGCGTGAAGTCCACGTTCTCTTCCTG
GATTTTCCCGGAATGCTGTCACATCTGGAGCTGACTCTTCAGGCATCCAAGCAAAATGGCACGGAGACCC
AGGAGGTGTTCCTGGTCCTCGTTTCGAACAAAAATGTCTTCGTGAAGTTCCAGGCCCCGGAAATCCCATT
GCACTTGGCCTACGACTCCAGCCTGGTCATCTTCCAAGGACAGCCAAGAGTCAACATCACAGTGCTACCA
TCCCTTACCTCCAGGAAACAGATCCTCGACTGGGCAGCCACCAAGGGCGCCATCACCTCGATAGCAGCAC
TGGATGACCCCCAAAGCATCGTCCTCCAGTTGGGCCAAGACCCAAAGGCACCATTCTTGTGCTTGCCAGA
AGCTCACAAGGACATGGGCGCCACACTTGAATGGCAACCACGAGCCCAGACCCCAGTCCAAAGCTGTCGC
TTGGAAGGTGTGTCTGGCCACAAGGAGGCCTACATCCTGAGGATCCTGCCAGGTTCTGAGGCCGGGCCCC
GGACGGTGACCGTAATGATGGAACTGAGTTGCACATCTGGGGACGCCATTCTCATCCTGCATGGTCCTCC
ATATGTCTCCTGGTTCATCGACATCAACCACAGCATGCAGATCTTGACCACAGGTGAATACTCCGTCAAG
ATCTTTCCAGGAAGCAAGGTCAAAGGCGTGGAGCTCCCAGACACACCCCAAGGCCTGATAGCGGAGGCCC
GCAAGCTCAATGCCAGCATTGTCACCTCCTTTGTAGAGCTCCCTCTGGTCAGCAATGTCTCCCTGAGGGC
CTCCAGCTGCGGTGGTGTGTTCCAGACCACCCCTGCACCCGTTGTGACCACACCTCCCAAGGACACATGC
AGCCCCGTGCTACTCATGTCCCTGATCCAGCCAAAGTGTGGCAATCAGGTCATGACTCTGGCACTCAATA
AAAAACACGTGCAGACTCTCCAGTGCACCATCACAGGCCTGACTTTCTGGGACTCCAGCTGCCAGGCTGA
AGACACTGACGACCATCTTGTCCTGAGTAGCGCCTACTCCAGCTGCGGCATGAAAGTGACAGCCCATGTG
GTCAGCAATGAGGTGATCATCAGTTTCCCGTCAGGCTCACCACCACTTCGGAAAAAGGTACAGTGCATCG
ACATGGACAGCCTCTCCTTCCAGCTGGGCCTCTACCTCAGCCCGCACTTCCTCCAGGCATCCAACACCAT
CGAACTAGGCCAGCAGGCCTTCGTACAGGTGAGCGTGTCTCCATTGACCTCTGAGGTCACAGTCCAGCTA
GATAGCTGCCATCTGGACTTGGGGCCCGAAGGGGACATGGTGGAACTCATCCAGAGCCGAACAGCCAAGG
GCAGCTGTGTGACCTTGCTGTCTCCAAGCCCTGAAGGTGACCCACGCTTCAGCTTCCTCCTCCGGGTCTA
CATGGTGCCCACACCCACCGCTGGCACCCTCAGTTGCAACTTAGCTCTGCGCCCTAGCACCTTGTCCCAG
GAAGTCTACAAGACAGTCTCCATGCGCCTGAACATCGTCAGCCCTGACCTGTCTGGTAAAGGCCTTGTCC
TGCCCTCTGTACTGGGTATCACCTTTGGTGCCTTCCTGATTGGGGCCCTGCTCACAGCTGCACTCTGGTA
CATCTATTCTCACACACGTGAGTATCCCAAGCCTCCACCCCATTCCCACAGCAAGCGCTCAGGGCCCGTC
CACACCACCCCGGGGCACACCCAGTGGAGCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG222690 representing NM_001146350
Red=Cloning site Green=Tags(s)

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFL
DFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLP
SLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCR
LEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVK
IFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTC
SPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHV
VSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQL
DSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQ
EVYKTVSMRLNIVSPDLSGKGLVLPSVLGITFGAFLIGALLTAALWYIYSHTREYPKPPPHSHSKRSGPV
HTTPGHTQWSL

TRTRPLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001146350
ORF Size 1923 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001146350.1, NP_001139822.1
RefSeq Size 3572 bp
RefSeq ORF 1926 bp
Locus ID 13805
Cytogenetics 2 22.09 cM
Gene Summary Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis (PubMed:10625534). Required for normal structure and integrity of adult vasculature (By similarity). Regulates the migration of vascular endothelial cells (PubMed:17540773). Required for normal extraembryonic angiogenesis and for embryonic heart development (PubMed:10625534). May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis (PubMed:28530658). May play a role in the binding of endothelial cells to integrins. Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors (PubMed:23300529). Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3 (By similarity).[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.