Anxa6 (NM_013472) Mouse Tagged ORF Clone

CAT#: MG222645

Reviews ()
Write a review
  • TrueORF®

Anxa6 (GFP-tagged) - Mouse annexin A6 (Anxa6) transcript variant 1, (10ug)

  View "NM_013472" in other vectors (6)

USD 980.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Anxa6 (NM_013472) Mouse Tagged ORF Clone
Symbol Anxa6
Synonyms Anx6; AnxVI; AW107198; Cabm; Camb
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG222645 representing NM_013472
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAATAGCACAGGGTGCCATGTACCGAGGCTCTGTCCACGACTTCCCAGAGTTTGACGCAAATC
AGGATGCTGAGGCCTTGTACACAGCCATGAAGGGCTTCGGCAGTGACAAGGAGTCCATACTGGAGCTGAT
CACCTCCCGCAGCAACAAGCAGAGGCAGGAGATCTGCCAGAATTACAAGTCCCTGTATGGCAAGGACCTC
ATCGAAGACTTGAAGTATGAGTTGACGGGGAAGTTCGAGCGGCTGATAGTGAACCTGATGAGGCCACTTG
CCTATTGTGACGCCAAAGAGATTAAAGACGCCATCTCGGGCGTTGGCACAGATGAGAAGTGCCTTATTGA
AATTTTGGCTTCCCGGACCAATGAGCAGATGCACCAGCTGGTGGCCGCATACAAAGACGCCTATGAGCGA
GACCTGGAATCTGACATCATTGGAGACACTTCCGGCCACTTCCAGAAGATGCTGGTGGTACTGCTCCAGG
GAACCCGGGAGAATGACGATGTTGTGAGCGAGGATTTGGTCCAGCAGGATGTCCAGGACCTGTATGAGGC
AGGGGAACTGAAATGGGGAACAGATGAGGCCCAGTTCATCTACATCTTGGGAAACCGCAGCAAACAGCAC
CTACGACTGGTGTTTGATGAGTATCTGAAGACCACAGGGAAGCCCATCGAAGCCAGTATCAGAGGGGAGC
TGTCTGGAGACTTTGAGAAGCTGATGTTGGCCGTGGTGAAGTGCATCCGAAGCACCCCGGAGTATTTTGC
GGAAAGGCTGTTCAAAGCCATGAAGGGCCTAGGGACCCGAGACAACACTCTGATCCGCATCATGGTCTCC
AGGAGCGAGCTGGATATGCTTGACATCCGGGAGATCTTCCGGACCAAGTATGAGAAGTCACTCTACAGCA
TGATCAAGAATGATACTTCCGGTGAATACAAGAAGGCTCTGCTGAAGCTGTGTGGAGGAGATGATGATGC
CGCTGGCCAGTTCTTCCCGGAGGCAGCACAGGTGGCCTATCAGATGTGGGAACTTAGTGCAGTGTCCCGA
GTCGAGCTGAAGGGTACTGTGTGTGCAGCCAATGATTTCAACCCTGACGCTGATGCCAAGGCCCTGCGGA
AAGCCATGAAGGGAATTGGAACTGATGAAGCCACCATCATCGACATCGTCACCCACCGGAGCAACGCCCA
GCGGCAGCAGATCCGGCAGACCTTCAAATCTCACTTTGGCCGGGATTTAATGGCTGACCTGAAGTCAGAG
ATCTCGGGAGACCTGGCAAGGCTGATTCTGGGGCTCATGATGCCACCTGCCCATTACGATGCTAAGCAGC
TGAAGAAAGCTATGGAGGGAGCCGGCACAGATGAAAAGACTCTCATAGAAATCCTGGCCACCCGGACCAA
TGCTGAAATCCGGGCCATCAACGAGGCCTACAAGGAGGATTATCACAAGTCCCTGGAGGATGCCTTGAGC
TCAGACACATCTGGCCACTTCAGAAGGATTCTCATTTCTCTGGCCACAGGAAATCGAGAGGAAGGAGGAG
AAAACCGGGACCAGGCCCAGGAAGATGCCCAGGTGGCTGCTGAGATCTTGGAAATAGCAGACACCCCCAG
CGGAGACAAAACTTCCTTGGAGACACGCTTCATGACCGTCCTGTGCACCCGTAGCTATCCCCACCTGCGC
AGAGTCTTCCAGGAGTTCATCAAGAAGACCAACTATGACATAGAGCATGTCATCAAGAAGGAGATGTCTG
GGGATGTCAAGGACGCATTTGTGGCCATCGTTCAGAGTGTCAAGAACAAGCCTCTCTTCTTTGCTGATAA
ACTGTACAAGTCCATGAAGGGTGCTGGCACAGATGAGAAGACCCTCACCAGGGTGATGGTGTCTCGGAGT
GAGATAGATCTGCTCAACATCCGGAGGGAATTCATTGAGAAATATGACAAGTCTCTACACCAAGCCATTG
AGGGTGACACCTCTGGAGACTTCATGAAGGCTTTGCTTGCTCTGTGTGGCGGAGAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG222645 representing NM_013472
Red=Cloning site Green=Tags(s)

MAKIAQGAMYRGSVHDFPEFDANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQNYKSLYGKDL
IEDLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGVGTDEKCLIEILASRTNEQMHQLVAAYKDAYER
DLESDIIGDTSGHFQKMLVVLLQGTRENDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH
LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS
RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKLCGGDDDAAGQFFPEAAQVAYQMWELSAVSR
VELKGTVCAANDFNPDADAKALRKAMKGIGTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKEDYHKSLEDALS
SDTSGHFRRILISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTVLCTRSYPHLR
RVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRVMVSRS
EIDLLNIRREFIEKYDKSLHQAIEGDTSGDFMKALLALCGGED

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_013472
ORF Size 2019 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013472.4, NP_038500
RefSeq Size 2661
RefSeq ORF 2022
Locus ID 11749
Cytogenetics 11 32.13 cM
Gene Summary May associate with CD21. May regulate the release of Ca(2+) from intracellular stores. [UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Anxa6"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones