Rbm8a (NM_025875) Mouse Tagged ORF Clone

CAT#: MG218181

Rbm8a (tGFP-tagged) - Mouse RNA binding motif protein 8a (Rbm8a) transcript variant 2, (10ug)

Product Images

Circular map for MG218181

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Rbm8a
• Synonyms: 2310057C03Rik; AA673428; Rbm8
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG218181 representing NM_025875
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGACGTGCTGGATCTTCACGAGGCGGGGGGCGAAGATTTCGCCATGGATGAGGATGGGGACGAAA
  GCATCCACAAACTAAAAGAAAAAGCAAAGAAACGGAAGGGCCGCGGCTTTGGCTCCGAGGGGTCCCGAGC
  GCGGATGCGGGAGGATTACGACAGTGTGGAGCAGGACGGCGATGAACCTGGACCACAGCGCTCTGTTGAA
  GGTTGGATTCTCTTTGTCACTGGAGTCCACGAAGAAGCCACTGAAGAAGATATCCATGACAAATTCGCTG
  AATATGGGGAAATAAAAAATATTCACCTTAATTTGGACAGGCGCACGGGATACTTGAAGGGGTATACTCT
  AGTTGAATATGAAACATACAAAGAGGCTCAGGCTGCCATGGAAGGACTAAATGGTCAAGATTTGATGGGG
  CAGCCAATCAGTGTGGACTGGTGTTTTGTTCGTGGACCACCAAAGGGCAAGAGGAGAGGAGGCCGAAGAC
  GAAGCAGGAGTCCAGACCGGAGACGCCGT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG218181 representing NM_025875
  Red=Cloning site Green=Tags(s)
  
  MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEGSRARMREDYDSVEQDGDEPGPQRSVE
  GWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMG
  QPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025875
• ORF Size: 519 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_025875.2, NP_080151.2
• RefSeq Size: 2628 bp
• RefSeq ORF: 522 bp
• Locus ID: 60365
• UniProt ID: Q9CWZ3
• Cytogenetics: 3 F2.1
• Gene Summary: Required for pre-mRNA splicing as component of the spliceosome (By similarity). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs (By similarity).[UniProtKB/Swiss-Prot Function]