Elovl1 (NM_019422) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG216933
Elovl1 (tGFP-tagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2 SUR4/Elo3 yeast)-like 1 (Elovl1) transcript variant 2, (10ug)
  $650.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Elovl1
Synonyms AA407424; BB151133; Ssc1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216933 representing NM_019422
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCTGTTGTGAACTTGTACCACGAGCTGATGAAGCATGCGGATCCCCGGATCCAAAGCTACCCTC
TGATGGGGTCCCCCTTGCTAATAACATCCATCCTTCTGACCTATGTGTACTTCATCCTATCGCTTGGGCC
TCGAATCATGGCTAATCGGAAGCCCTTCCAACTTCGAGGCTTCATGATTGTCTACAATTTCTCACTGGTG
ATACTCTCCCTCTACATTGTCTATGAGTTTCTGATGTCTGGTTGGCTGAGTACCTACACCTGGCGCTGTG
ACCCCATAGACTTTTCCAATAGCCCTGAAGCACTTCGGATGGTTCGAGTGGCCTGGCTCTTCATGCTTTC
CAAGGTCATTGAGCTGATGGACACAGTGATATTTATCCTCCGGAAGAAGGACGGGCAAGTGACCTTCCTC
CATGTCTTCCACCACTCGGTGCTTCCCTGGAGTTGGTGGTGGGGGATAAAAATTGCTCCAGGAGGAATGG
GCTCCTTCCATGCCATGATAAACTCCTCTGTACATGTCGTCATGTACCTCTACTATGGATTGTCTGCCCT
TGGCCCTGTGGCCCAGCCCTACCTTTGGTGGAAGAAACATATGACTGCCATTCAGCTGATCCAGTTTGTC
CTGGTCTCACTGCACATCAGCCAATACTACTTCATGCCCAGCTGCAACTACCAGTACCCCATCATCATCC
ACCTCATCTGGATGTATGGCACCATCTTCTTCATACTGTTCTCCAATTTCTGGTATCACTCTTACACCAA
GGGGAAGCGGCTGCCCCGTGCAGTTCAGCAAAATGGAGCTCCAGCTACCACCAAGGTCAAGGCCAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216933 representing NM_019422
Red=Cloning site Green=Tags(s)

MEAVVNLYHELMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRGFMIVYNFSLV
ILSLYIVYEFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFL
HVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFV
LVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_019422
ORF Size 837 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019422.3
RefSeq Size 1774 bp
RefSeq ORF 840 bp
Locus ID 54325
UniProt ID Q9JLJ5
Cytogenetics 4 D2.1
Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that exhibits activity toward saturated and monounsaturated acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. May participate in the production of both saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_019422" in other vectors (4)
SKU Description Size Price
MC209963 Elovl1 (untagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1 (Elovl1), transcript variant 2, (10ug) 10 ug
$450.00
MR216933 Elovl1 (Myc-DDK-tagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1 (Elovl1), transcript variant 2 10 ug
$450.00
MR216933L3 Lenti ORF clone of Elovl1 (Myc-DDK-tagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1 (Elovl1), transcript variant 2 10 ug
$750.00
MR216933L4 Lenti ORF clone of Elovl1 (mGFP-tagged) - Mouse elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1 (Elovl1), transcript variant 2 10 ug
$750.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.