Raly (NM_001139512) Mouse Tagged ORF Clone

CAT#: MG216731

Reviews ()
Write a review
  • TrueORF®

Raly (GFP-tagged) - Mouse hnRNP-associated with lethal yellow (Raly) transcript variant 4, (10ug)


  View "NM_001139512" in other vectors (5)

USD 300.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Raly (NM_001139512) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Raly
Synonyms AI663842; Merc
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG216731 representing NM_001139512
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTGAAGATTCAGACCAGCAATGTAACCAACAAGAATGACCCTAAGTCCATCAACTCTCGGGTCT
TCATCGGAAATCTAAACACAGCTGTGGTGAAGAAGTCAGATGTGGAGACCATCTTTTCCAAGTACGGCCG
AGTGGCTGGTTGCTCTGTGCACAAAGGCTATGCTTTTGTCCAGTATGCCAATGAGCGCCATGCCCGGGCA
GCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCTGGACAGACCCTGGACATCAACATGGCTGGAGAGCCCA
AGCCTAATAGACCCAAGGGGCTAAAGAGAGCAGCAACTGCCATCTACAGGCTGTTTGATTATCGAGGCCG
CCTTTCTCCAGTGCCTGTGCCCAGGGCAGTTCCAGTGAAGCGACCCCGTGTTACAGTCCCTTTGGTTCGC
CGTGTCAAAACTACGATACCTGTCAAGCTCTTTGCCCGCTCCACAGCTGTCACTACTGGCTCAGCCAAAA
TCAAGTTAAAGAGCAGTGAGCTACAGACCATCAAAACAGAGCTGACACAGATCAAGTCCAACATCGATGC
CCTGTTGGGTCGCTTGGAACAGATTGCTGAGGAACAGAAGGCCAACCCAGATGGCAAGAAGAAGGGTGAC
AGCAGCAGTGGTGGAGGAGGAGGCAGCAGTGGTGGAGGCGGCAGTAGCAATGTTGGTGGTGGCAGCGGCG
GCGGCAGCGGGAGCTGCAGCAGCAGCAGCCGGCTACCAGCGCCCCAAGAAGACACGGCTTCTGAGGCAGG
CACACCCCAAGGAGAAGTCCAAACTCGAGATGATGGTGATGAGGAGGGACTGCTAACACATAGCGAGGAG
GAGCTGGAGCACAGCCAGGACACAGATGCAGAAGATGGAGCCTTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG216731 representing NM_001139512
Red=Cloning site Green=Tags(s)

MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARA
AVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVR
RVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDGKKKGD
SSSGGGGGSSGGGGSSNVGGGSGGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEE
ELEHSQDTDAEDGALQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001139512
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001139512.1, NP_001132984.1
RefSeq Size 1477
RefSeq ORF 891
Locus ID 19383
Cytogenetics 2 76.83 cM

Other Versions

Other products for "Raly"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones