Ffar2 (NM_001168512) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG216649
Ffar2 (tGFP-tagged) - Mouse free fatty acid receptor 2 (Ffar2) transcript variant 5, (10ug)
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ffar2
Synonyms GPCR43; Gpr43
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216649 representing NM_001168512
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCCAGACTGGCACAGTTCCTTGATCCTCACGGCCTACATCCTCATCTTTCTTACTGGGCTCCCTG
CCAACCTGCTGGCCCTGCGGGCCTTCATGGGCCGGGTTCGCCAGCCTCAGCCTGCCCCTGTGCACATCCT
CCTGCTTAATCTGACCCTGGCGGACTTGCTCCTGTTGCTGCTGCTGCCCTTCCGGATCGTGGAAGCAGCA
TCCAACTTCCGCTGGTACCTACCAAAGATCGTGTGCGCGCTGACAGGCTTCGGCTTCTACAGCAGCATCT
ACTGCAGCACGTGGCTGCTGGCGGGCATCAGCATGGAACGCTACCTGGGAGTGGCCTTCCCGGTGCAGTA
CAAGTTATCCCGCCGGCCACTGTATGGAGTGATCGCTGCTCTGGTGGCCTGGATCATGTCCTTTGGCCAC
TGCACCATCGTCATCATCGTTCAGTACCTGAACTCAACTGAGCAGGTGGGCACTGAGAACCAAATAACCT
GCTACGAGAACTTCACCCAAGAGCAGCTGGATGTGGTACTGCCCGTACGACTGGAGCTGTGCCTGGTCCT
GTTTTTCGTTCCCATGGCAGTCACCATCTTCTGTTATTGGCGCTTCGTGTGGATCATGCTCACGCAGCCC
CACGTTGGGGCTCAGAGGCGACGCCGGGCAGTGGGCCTGGCTGTTGTGACGCTTCTTAATTTCCTGGTGT
GCTTTGGACCCTACAACATGTCCCACCTGGTGGGGTTCTACCTGAGGCAGAGCCCCTCGTGGCGGGTGGA
GGCTGTGGTGTTCAGTTCCCTCAATGCCAGCCTGGATCCATTATTGTTCTACTTCTCCTCCTCCGTGGTG
CGCAGAGCTTTTGGGAAAGGTTTGCTACTGATCCGCAATCCTGCCTCCTCTATGCTGGGCAGGGGAGCCA
AAGAGACAGTGGAGGGGACCAAGATGGACAGGGGTGGAAGTCAAGCAGAAGGGGTACAGAGTTCTGAATT
TGTCACCGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216649 representing NM_001168512
Red=Cloning site Green=Tags(s)

MTPDWHSSLILTAYILIFLTGLPANLLALRAFMGRVRQPQPAPVHILLLNLTLADLLLLLLLPFRIVEAA
SNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISMERYLGVAFPVQYKLSRRPLYGVIAALVAWIMSFGH
CTIVIIVQYLNSTEQVGTENQITCYENFTQEQLDVVLPVRLELCLVLFFVPMAVTIFCYWRFVWIMLTQP
HVGAQRRRRAVGLAVVTLLNFLVCFGPYNMSHLVGFYLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVV
RRAFGKGLLLIRNPASSMLGRGAKETVEGTKMDRGGSQAEGVQSSEFVTE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001168512
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001168512.1, NP_001161984.1
RefSeq Size 2059 bp
RefSeq ORF 993 bp
Locus ID 233079
UniProt ID Q8VCK6
Cytogenetics 7 B1
Summary G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins but also to the Gq family (PubMed:23589301). Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation. May play a role in glucose homeostasis by regulating the secretion of GLP-1, in response to short-chain fatty acids accumulating in the intestine (PubMed:22190648, PubMed:23589301). May also regulate the production of LEP/Leptin, a hormone acting on the central nervous system to inhibit food intake (PubMed:20399779). Finally, may also regulate whole-body energy homeostasis through adipogenesis regulating both differentiation and lipid storage of adipocytes (PubMed:16123168, PubMed:23589301). In parallel to its role in energy homeostasis, may also mediate the activation of the inflammatory and immune responses by SCFA in the intestine, regulating the rapid production of chemokines and cytokines (PubMed:23665276). May also play a role in the resolution of the inflammatory response and control chemotaxis in neutrophils (PubMed:19917676, PubMed:19865172). In addition to SCFAs, may also be activated by the extracellular lectin FCN1 in a process leading to activation of monocytes and inducing the secretion of interleukin-8/IL-8 in response to the presence of microbes.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001168512" in other vectors (3)
SKU Description Size Price
MR216649 Ffar2 (Myc-DDK-tagged) - Mouse free fatty acid receptor 2 (Ffar2), transcript variant 5 10 ug
$289.00 $300.00
MR216649L3 Lenti ORF clone of Ffar2 (Myc-DDK-tagged) - Mouse free fatty acid receptor 2 (Ffar2), transcript variant 5 10 ug
$600.00
MR216649L4 Lenti ORF clone of Ffar2 (mGFP-tagged) - Mouse free fatty acid receptor 2 (Ffar2), transcript variant 5 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.