Lsm10 (NM_138721) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG216351
Lsm10 (tGFP-tagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10) transcript variant 1, (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lsm10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216351 representing NM_138721
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTGAGCCACTCGGTGAAGGAGCGAACTATTTCTGAGAACAGCCTGATCATCCTGTTGCAGGGCC
TCCAAGGCCAAATAACCACTGTGGACCTTCGGGATGAGAGTGTGGCCCGAGGACGCATTGACAACGTGGA
TGCTTTCATGAATATCCGCCTGGCCAATGTCACCTATACCGACCGCTGGGGACATCAGGTTGAGTTGGAT
GACCTTTTTGTGACCGGTCGTAACGTCCGATACGTCCATATCCCAGATGGTGTGGACATCACTGCTACTA
TTGAGCAGCAGCTGCAGATCATCCACCGTGTGCGCAACTTTGGTGGCAAGGGTCAAGGTCGTCGAGAGTT
CCCCTCCAAAAGGCCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216351 representing NM_138721
Red=Cloning site Green=Tags(s)

MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYTDRWGHQVELD
DLFVTGRNVRYVHIPDGVDITATIEQQLQIIHRVRNFGGKGQGRREFPSKRP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_138721
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138721.2, NP_620046.1
RefSeq Size 927 bp
RefSeq ORF 369 bp
Locus ID 116748
UniProt ID Q8QZX5
Cytogenetics 4 D2.2
Summary Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing (By similarity). Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed (By similarity). Required for cell cycle progression from G1 to S phases (By similarity). Binds specifically to U7 snRNA (By similarity). Binds specifically to U7 snRNA (By similarity). Binds to the downstream cleavage product (DCP) of histone pre-mRNA.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_138721" in other vectors (6)
SKU Description Size Price
MC204183 Lsm10 (untagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), transcript variant 1, (10ug) 10 ug
$150.00
MC207206 Lsm10 (untagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), transcript variant 1, (10ug) 10 ug
$165.00
MG200601 Lsm10 (tGFP-tagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10) 10 ug
$350.00
MR216351 Lsm10 (Myc-DDK-tagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), transcript variant 1 10 ug
$289.00
MR216351L3 Lenti ORF clone of Lsm10 (Myc-DDK-tagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), transcript variant 1 10 ug
$450.00
MR216351L4 Lenti ORF clone of Lsm10 (mGFP-tagged) - Mouse U7 snRNP-specific Sm-like protein LSM10 (Lsm10), transcript variant 1 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.