Lamtor5 (NM_026774) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG216224
Lamtor5 (tGFP-tagged) - Mouse hepatitis B virus x interacting protein (Hbxip), (10ug)
  $365.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lamtor5
Synonyms 1110003H18Rik; Hbxip; XIP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216224 representing NM_026774
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTTTCGTAAAGAGCGCGGACGCGGCGCCGCGCTGAATTTCGTCCCTCTGGAGACGCCGTCCAGGC
GCCCGCCTCGGTCAAGTCACGTGATCGAGGTTTGCGGTGAAGGAGGAAGTGTTTTGCTGCGGGGTCCTGG
CCTGGGGCGGACAGCCTGCGGGATGGAGGCGACTTTGGAGCAGCATTTGGAGGACACAATGAAGAATCCA
TCCATTGTTGGAGTCCTATGCACAGATTCACAAGGACTTAATCTGGGCTGCCGTGGTACCCTGTCGGATG
AGCACGCTGGAGTCATATCTGTTCTAGCCCAGCAGGCAGCTAGGCTAACCTCTGACCCCACCGACATCCC
TGTGGTATGTTTAGAATCAGATAATGGGAACATTATGATCCAGAAACACGATGGCATCACAGTGGCTGTG
CACAAAATGGCCTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216224 representing NM_026774
Red=Cloning site Green=Tags(s)

MPFRKERGRGAALNFVPLETPSRRPPRSSHVIEVCGEGGSVLLRGPGLGRTACGMEATLEQHLEDTMKNP
SIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAARLTSDPTDIPVVCLESDNGNIMIQKHDGITVAV
HKMAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026774
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026774.2, NP_081050.2
RefSeq Size 905 bp
RefSeq ORF 438 bp
Locus ID 68576
UniProt ID Q9D1L9
Cytogenetics 3 F2.3
Summary As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026774" in other vectors (4)
SKU Description Size Price
MC210751 Lamtor5 (untagged) - Mouse hepatitis B virus x interacting protein (Hbxip), (10ug) 10 ug
$165.00
MR216224 Lamtor5 (Myc-DDK-tagged) - Mouse hepatitis B virus x interacting protein (Hbxip) 10 ug
$165.00
MR216224L3 Lenti ORF clone of Lamtor5 (Myc-DDK-tagged) - Mouse hepatitis B virus x interacting protein (Hbxip) 10 ug
$465.00
MR216224L4 Lenti ORF clone of Lamtor5 (mGFP-tagged) - Mouse hepatitis B virus x interacting protein (Hbxip) 10 ug
$465.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.