Glrx2 (NM_023505) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG216026
Glrx2 (tGFP-tagged) - Mouse glutaredoxin 2 (thioltransferase) (Glrx2) transcript variant 2, (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Glrx2
Synonyms 1700010P22Rik; AI645710; Grx2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216026 representing NM_023505
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAACAGCACATCGTCGTTTTGGGGGAAGTCTACAACTACTCCTGTGAACCAGATCCAAGAAACAA
TTTCTAACAATTGTGTGGTGATCTTCTCAAAAACATCCTGCTCTTACTGTTCCATGGCCAAGAAGATTTT
CCATGACATGAATGTCAACTACAAGGCTGTGGAGTTGGATATGCTGGAATATGGCAACCAGTTTCAAGAT
GCGCTTCACAAGATGACTGGGGAAAGAACCGTTCCCAGGATATTTGTCAATGGACGATTTATTGGAGGCG
CAGCGGACACTCACAGGCTTCACAAAGAAGGGAAATTGCTGCCTCTGGTTCATCAGTGTTATTTAAAAAA
AAAACAAGAGGAAAGACAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216026 representing NM_023505
Red=Cloning site Green=Tags(s)

MGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQD
ALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_023505
ORF Size 369 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_023505.2, NP_075994.2
RefSeq Size 3482 bp
RefSeq ORF 372 bp
Locus ID 69367
UniProt ID Q923X4
Cytogenetics 1 62.53 cM
Summary Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_023505" in other vectors (4)
SKU Description Size Price
MC210911 Glrx2 (untagged) - Mouse glutaredoxin 2 (thioltransferase) (Glrx2), transcript variant 2, (10ug) 10 ug
$165.00
MR216026 Glrx2 (Myc-DDK-tagged) - Mouse glutaredoxin 2 (thioltransferase) (Glrx2), transcript variant 2 10 ug
$289.00
MR216026L3 Lenti ORF clone of Glrx2 (Myc-DDK-tagged) - Mouse glutaredoxin 2 (thioltransferase) (Glrx2), transcript variant 2 10 ug
$450.00
MR216026L4 Lenti ORF clone of Glrx2 (mGFP-tagged) - Mouse glutaredoxin 2 (thioltransferase) (Glrx2), transcript variant 2 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.