Tsen15 (NM_025677) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215931
Tsen15 (tGFP-tagged) - Mouse tRNA splicing endonuclease 15 homolog (S. cerevisiae) (Tsen15), (10ug)
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tsen15
Synonyms 5730449L18Rik; AL023077; Sen15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215931 representing NM_025677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCGCAGCGATTCCGAACCTACCCCGGGATGTAGCGGGCCTGGCCCGGCTCCCGTTCGCGATG
GCGGCGGCGCCCACACATGGGCTCCGGAGGACGCCTGGATGGGCACACACCCTAAGTACTTAGAAATGAT
GGAATTAGATATAGGAGATGCCACCCAAGTTTATATAGCATTCTTGGTTTACCTGGATCTCATGGAGAGT
AAAAGTTGGCATGAAGTAAACTGTGTAGGAATACCAGAACTACAACTCATCTGCCTCCTTGGCACTGAGA
TCGAAGGGGAAGGGCTGCAGACGGTGGTGCCTACACCCATTTCTGCTTCCCTCAGCCATAATAGGATAAG
GGAAATCTTGAAGGCGTCTAGAAAGTTGCAAGGCGATCCAGAACTGCCGATGTCTTTTACTTTGGCCATA
GTGGAGTCAGATTCCACAATAGTCTATTATAAACTTACCGATGGATTTATGCTGCCAGACCCTCAGAATA
TTTCTCTTAGAAGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215931 representing NM_025677
Red=Cloning site Green=Tags(s)

MEERSDSEPTPGCSGPGPAPVRDGGGAHTWAPEDAWMGTHPKYLEMMELDIGDATQVYIAFLVYLDLMES
KSWHEVNCVGIPELQLICLLGTEIEGEGLQTVVPTPISASLSHNRIREILKASRKLQGDPELPMSFTLAI
VESDSTIVYYKLTDGFMLPDPQNISLRR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025677
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025677.3, NP_079953.2
RefSeq Size 1147 bp
RefSeq ORF 507 bp
Locus ID 66637
UniProt ID Q8R3W5
Cytogenetics 1 G2
Summary Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025677" in other vectors (4)
SKU Description Size Price
MC210410 Tsen15 (untagged) - Mouse tRNA splicing endonuclease 15 homolog (S. cerevisiae) (Tsen15), (10ug) 10 ug
$330.00
MR215931 Tsen15 (Myc-DDK-tagged) - Mouse tRNA splicing endonuclease 15 homolog (S. cerevisiae) (Tsen15) 10 ug
$289.00 $300.00
MR215931L3 Lenti ORF clone of Tsen15 (Myc-DDK-tagged) - Mouse tRNA splicing endonuclease 15 homolog (S. cerevisiae) (Tsen15) 10 ug
$600.00
MR215931L4 Lenti ORF clone of Tsen15 (mGFP-tagged) - Mouse tRNA splicing endonuclease 15 homolog (S. cerevisiae) (Tsen15) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.