OriGene Logo

Mreg (NM_001005423) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG215346
Mreg (tGFP-tagged) - Mouse melanoregulin (Mreg), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Mreg or NM_001005423"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mreg
Synonyms dsu; Gm974; Wdt2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215346 representing NM_001005423
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGCGCCGCTGGCTACGGAGCGCCTGCTGCTGCTGCCCGTGCCGGTGCCTGGAGGAGCCCGCGC
GGCCCGAGAAGGAGCCGCTGGTCAGTGGTAACAATCCGTATTCCTCCTTTGGAGCGACTCTGGAGAGGGA
TGATGAGAAGAATTTATGGAGCATGCCTCATGACGTGTCCCACACAGAGGCGGATGACGATAGGATCTTG
TATAATTTGATAGTCATTCGTAATCAGCAGACCAAAGACTCAGAGGAATGGCAAAGACTCAACTATGATA
TCTACACCCTGCGGCAGATCCGCAGGGAAGTGAGGAACCGATGGAGACGAATCTTAGAGGACTTGGGCTT
TCAAAGGGAAGCCGACTCTCTGTTGTCAGTGACCAAACTCAGCACCATGAGTGATTCTAAAAACACAAGG
AAAGCCCGGGAGATGCTGTTAAAGCTGGCTGAAGAGACCTCTATCTTCCCCGCCAGCTGGGAGCTCTCCG
AGAGGTACCTCTTGGTTGTGGACCGGCTCATTGCTCTCGATGCTGCTGAGGACTTCTTTAAGATTGCTAG
CCAAATGTACCCCAAGAAACCTGGGGTCCCATGCCTGGTGGACGGCCAGAGAAAACTGCACTGCCTTCCA
TTTCCAAGCCCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215346 representing NM_001005423
Red=Cloning site Green=Tags(s)

MGLRRWLRSACCCCPCRCLEEPARPEKEPLVSGNNPYSSFGATLERDDEKNLWSMPHDVSHTEADDDRIL
YNLIVIRNQQTKDSEEWQRLNYDIYTLRQIRREVRNRWRRILEDLGFQREADSLLSVTKLSTMSDSKNTR
KAREMLLKLAEETSIFPASWELSERYLLVVDRLIALDAAEDFFKIASQMYPKKPGVPCLVDGQRKLHCLP
FPSP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001005423
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001005423.2, NP_001005423.1
RefSeq Size 2493 bp
RefSeq ORF 645 bp
Locus ID 381269
UniProt ID Q6NVG5
Cytogenetics 1 C3
Summary Probably functions as cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery (PubMed:22940130, PubMed:22275436, PubMed:30174147). Plays a role in hair pigmentation, a process that involves shedding of melanosome-containing vesicles from melanocytes, followed by phagocytosis of the melanosome-containing vesicles by keratinocytes (PubMed:15550542, PubMed:3410303, PubMed:22753477). Functions on melanosomes as receptor for RILP and the complex formed by RILP and DCTN1, and thereby contributes to retrograde melanosome transport from the cell periphery to the center (PubMed:22940130, PubMed:22275436). Overexpression causes accumulation of late endosomes and/or lysosomes at the microtubule organising center (MTOC) at the center of the cell (PubMed:19240024, PubMed:30174147). Probably binds cholesterol and requires the presence of cholesterol in membranes to function in microtubule-mediated retrograde organelle transport (PubMed:30174147). Binds phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, phosphatidylinositol 5-phosphate and phosphatidylinositol 3,5-bisphosphate, but not phosphatidylinositol 3,4-bisphosphate or phosphatidylinositol 4,5-bisphosphate (PubMed:19240024). Required for normal phagosome clearing and normal activation of lysosomal enzymes in lysosomes from retinal pigment epithelium cells (PubMed:19240024). Required for normal degradation of the lipofuscin component N-retinylidene-N-retinylethanolamine (A2E) in the eye (PubMed:19240024). May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (Probable).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001005423" in other vectors (4)
SKU Description Size Price
MC214698 Mreg (untagged) - Mouse melanoregulin (Mreg), (10ug) 10 ug
$330.00
MR215346 Mreg (Myc-DDK-tagged) - Mouse melanoregulin (Mreg) 10 ug
$289.00 $300.00
MR215346L3 Lenti ORF clone of Mreg (Myc-DDK-tagged) - Mouse melanoregulin (Mreg) 10 ug
$600.00
MR215346L4 Lenti ORF clone of Mreg (mGFP-tagged) - Mouse melanoregulin (Mreg) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.