Emc6 (NM_025318) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215036
Emc6 (tGFP-tagged) - Mouse transmembrane protein 93 (Tmem93) transcript variant 2, (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Emc6
Synonyms 0610009E20Rik; 0610025L18Rik; Tmem93
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215036 representing NM_025318
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGGTGGTGGCCAAGCGGGAAGGGCCGCCGTTCATCAGCGAGGCAGCCGTGCGAGGCAACGCCG
CGGTCCTGGATTACTGCCGGACCTCAGTGTCAGCGCTGTCCGGGGCCACCGCCGGCATCCTCGGCCTCAC
CGGCCTCTACGGCTTCATCTTCTACCTGCTTGCCTCCGTCCTGCTCTCCCTGCTCCTCATTCTCAAAGCG
GGAAGGAGGTGGAACAAATATTTTAAGTCACGAAGACCTCTCTTTACGGGAGGCCTCATTGGAGGCCTCT
TCACCTACGTCCTCTTTTGGACCTTCCTCTATGGCATGGTGCACGTCTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215036 representing NM_025318
Red=Cloning site Green=Tags(s)

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKA
GRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025318
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025318.3, NP_079594.1
RefSeq Size 1353 bp
RefSeq ORF 333 bp
Locus ID 66048
UniProt ID Q9CQW0
Cytogenetics 11 B4
Summary Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025318" in other vectors (4)
SKU Description Size Price
MG200421 Emc6 (tGFP-tagged) - Mouse transmembrane protein 93 (Tmem93) 10 ug
$350.00
MR215036 Emc6 (Myc-DDK-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2 10 ug
$289.00
MR215036L3 Lenti ORF clone of Emc6 (Myc-DDK-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2 10 ug
$450.00
MR215036L4 Lenti ORF clone of Emc6 (mGFP-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.