Tmem11 (NM_001168507) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215033
Tmem11 (tGFP-tagged) - Mouse transmembrane protein 11 (Tmem11) transcript variant 2, (10ug)
  $650.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tmem11
Synonyms 5730466P16Rik; AA409091
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215033 representing NM_001168507
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGTTGGAATGGTCAGCCTCTCAGCTACAGACTGCTACATTGTGCACGAAATCTACAGTGGGGAGA
ACGCCCAGGACCAGTTTGAGTATGAGCTGGAGCAGGCGCTGGAAGCCCAGTACAAGTACATTGTGATAGA
GCCCACCCGAATTGGAGACGAGACAGCACGCTGGATCACCGTAGGCAATTGCCTGCACAAGACGGCCGTG
TTGGCAGGTACTGCCTGCCTCTTCACCCCATTGGCACTGCCCCTGGATTACTCCCACTACATCTCCCTGC
CCGCTGGTGTGCTGAGCCTGGCCTGCTGTACCCTCTATGGGATCTCCTGGCAGTTTGACCCTTGCTGCAA
GTACCAGGTGGAGTATGATGCCTATAAACTGTCCCGCCTGCCTCTGCACACGCTCACCTCCTCCACACCA
GTGGTGCTGGTTCGGAAGGACGACCTGCACAGAAAGAGACTGCACAACACAATAGCCCTGGCTGCCCTGG
TGTACTGTGTAAAGAAGGTTTATGAGCTCTACGCCGTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215033 representing NM_001168507
Red=Cloning site Green=Tags(s)

MSVGMVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAV
LAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTP
VVLVRKDDLHRKRLHNTIALAALVYCVKKVYELYAV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001168507
ORF Size 528 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001168507.1, NP_001161979.1
RefSeq Size 1511 bp
RefSeq ORF 531 bp
Locus ID 216821
Cytogenetics 11 B2
Summary Plays a role in mitochondrial morphogenesis.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001168507" in other vectors (6)
SKU Description Size Price
MC212651 Tmem11 (untagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2, (10ug) 10 ug
$480.00
MR215033 Tmem11 (Myc-DDK-tagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2 10 ug
$450.00
MR215033L1 Lenti ORF clone of Tmem11 (Myc-DDK-tagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2 10 ug
$750.00
MR215033L2 Lenti ORF clone of Tmem11 (mGFP-tagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2 10 ug
$750.00
MR215033L3 Lenti ORF clone of Tmem11 (Myc-DDK-tagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2 10 ug
$750.00
MR215033L4 Lenti ORF clone of Tmem11 (mGFP-tagged) - Mouse transmembrane protein 11 (Tmem11), transcript variant 2 10 ug
$750.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.