Dnmt1 (NM_010066) Mouse Tagged ORF Clone

CAT#: MG212056

Dnmt1 (GFP-tagged) - Mouse DNA methyltransferase (cytosine-5) 1 (Dnmt1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 2,256.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Dnmt1 (NM_010066) Mouse Tagged ORF Clone
Symbol Dnmt1
Synonyms Cxxc9; Dnmt; Dnmt1o; m.MmuI; MCMT; Met-1; Met1; MommeD2; MTase
Vector pCMV6-AC-GFP
Sequence Data
>MG212056 representing NM_010066
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCGCGAACAGCTCCAGCCCGAGTGCCTGCGCTTGCCTCCCCGGCAGGCTCGCTCCCGGACCATG
TCCGCAGGCGGCTCAAAGACTTGGAAAGAGATGGCTTAACAGAAAAGGAGTGTGTGAGGGAGAAATTAAA
CTTACTGCATGAATTCCTGCAAACAGAAATAAAAAGCCAGTTGTGTGACTTGGAAACCAAATTACATAAA
GAGGAATTATCTGAGGAAGGCTACCTGGCTAAAGTCAAGTCCCTCTTAAATAAGGATTTGTCCTTGGAGA
ACGGAACACACACTCTCACTCAAAAAGCCAACGGTTGTCCCGCCAACGGGAGCCGGCCAACCTGGAGAGC
AGAAATGGCAGACTCAAATAGATCCCCAAGATCCAGGCCCAAGCCTCGGGGACCCAGGAGAAGCAAGTCG
GACAGTGACACCCTTTCAGTTGAAACTTCACCTAGTTCCGTGGCTACGAGGAGAACCACCAGGCAGACCA
CCATCACGGCTCACTTCACGAAGGGCCCCACTAAACGGAAACCCAAGGAAGAGTCGGAAGAGGGGAACTC
GGCTGAGTCGGCTGCAGAGGAGAGAGACCAGGATAAGAAACGCAGAGTTGTAGACACAGAGAGTGGTGCT
GCAGCTGCTGTGGAGAAACTGGAAGAGGTAACAGCGGGAACCCAGCTGGGTCCGGAAGAGCCATGTGAAC
AGGAAGATGACAACAGGAGTCTTCGACGTCACACCAGAGAGCTATCATTGAGGCGGAAATCAAAGGAGGA
TCCAGACAGAGAAGCAAGACCGGAAACTCACTTGGACGAGGACGAGGACGGAAAAAAGGATAAAAGAAGT
TCCAGACCCAGGAGCCAGCCCAGAGATCCAGCTGCCAAACGGAGACCCAAGGAAGCAGAGCCAGAGCAGG
TAGCTCCAGAGACTCCCGAGGACAGAGACGAGGATGAGAGGGAGGAGAAGAGACGAAAAACGACACGTAA
AAAACTGGAGTCACACACCGTTCCCGTTCAGAGCAGATCGGAGAGAAAAGCCGCTCAAAGCAAAAGTGTG
ATCCCGAAGATCAACTCACCAAAGTGCCCCGAGTGTGGCCAGCACCTAGACGACCCTAACCTGAAGTACC
AGCAGCACCCTGAGGATGCTGTGGATGAACCCCAGATGTTGACCAGTGAGAAACTGTCCATCTACGACTC
CACCTCGACCTGGTTTGATACTTATGAAGATTCTCCCATGCATAGGTTCACTTCCTTCAGTGTGTACTGC
AGTCGCGGGCACCTGTGTCCTGTCGACACCGGTCTCATTGAGAAGAATGTAGAGCTCTACTTTTCTGGGT
GTGCCAAAGCAATTCATGACGAGAATCCATCTATGGAAGGTGGTATTAATGGCAAAAACCTCGGGCCAAT
CAATCAGTGGTGGCTCAGTGGCTTTGATGGTGGCGAGAAGGTGCTCATTGGCTTCTCCACTGCATTTGCT
GAATACATTTTGATGGAGCCCAGCAAAGAGTATGAGCCAATATTTGGGCTGATGCAGGAGAAAATTTACA
TCAGCAAGATTGTTGTTGAGTTCCTGCAAAACAATCCTGATGCTGTATATGAAGACCTGATCAATAAGAT
TGAGACCACTGTTCCTCCTTCTACCATTAATGTGAACCGGTTCACAGAGGACTCCCTCTTACGCCACGCC
CAGTTTGTAGTGAGCCAGGTAGAGAGTTACGACGAAGCCAAGGACGATGATGAGACCCCCATCTTCTTGT
CTCCCTGTATGAGAGCCCTGATCCATTTGGCTGGTGTCTCCCTGGGACAGAGGCGAGCAACAAGGCGCGT
CATGGGTGCTACCAAGGAGAAGGACAAAGCACCCACGAAAGCCACCACCACCAAGCTGGTCTATCAGATC
TTTGACACTTTCTTCTCAGAGCAGATTGAGAAGTATGATAAGGAGGACAAGGAGAATGCCATGAAGCGCC
GCCGCTGTGGTGTCTGTGAGGTCTGTCAGCAGCCTGAGTGTGGGAAGTGCAAGGCGTGCAAAGATATGGT
GAAGTTTGGTGGCACTGGACGGAGTAAGCAGGCTTGCCTCAAGAGGAGGTGTCCTAACTTGGCGGTGAAG
GAGGCAGACGACGATGAAGAGGCTGATGATGATGTGTCAGAGATGCCATCACCCAAAAAGCTGCATCAGG
GGAAGAAGAAGAAGCAGAACAAGGACCGCATCTCCTGGCTTGGGCAGCCTATGAAGATTGAAGAGAATAG
AACTTACTATCAGAAGGTGAGCATCGATGAGGAGATGCTAGAGGTGGGCGACTGCGTCTCGGTCATTCCA
GATGATTCCTCCAAACCACTCTATCTAGCCAGGGTCACAGCTCTGTGGGAAGACAAAAATGGTCAGATGA
TGTTCCATGCGCACTGGTTCTGCGCTGGGACAGACACAGTCCTGGGAGCCACCTCCGACCCCCTGGAACT
GTTCCTGGTGGGCGAGTGCGAAAACATGCAGCTTTCCTACATCCACAGCAAGGTCAAGGTCATCTACAAA
GCCCCTTCTGAAAACTGGGCCATGGAGGGAGGCACAGACCCTGAGACCACACTGCCTGGGGCTGAGGATG
GCAAGACTTACTTCTTCCAGCTCTGGTACAACCAGGAGTACGCAAGGTTTGAATCCCCACCCAAGACCCA
GCCGACCGAGGACAACAAGCACAAGTTCTGCCTATCTTGTATCCGGCTGGCTGAGCTGAGACAAAAAGAA
ATGCCCAAGGTCCTGGAACAAATTGAGGAGGTGGATGGCCGGGTCTACTGCAGTTCCATCACCAAGAATG
GTGTTGTCTACCGACTGGGTGACAGTGTGTACCTTCCTCCCGAGGCCTTTACTTTCAACATCAAAGTGGC
TAGCCCCGTGAAACGCCCAAAGAAGGATCCTGTGAACGAGACCCTGTACCCTGAGCACTACCGCAAGTAT
TCTGACTACATCAAGGGGAGCAACCTGGATGCTCCAGAGCCCTATCGCATCGGTCGGATAAAAGAGATCC
ACTGTGGCAAGAAGAAAGGCAAGGTCAACGAGGCAGACATCAAGCTGAGGCTCTACAAGTTCTACAGGCC
TGAGAATACCCACAGGTCCTACAACGGATCCTATCACACTGACATCAACATGCTTTACTGGAGCGACGAG
GAAGCTGTGGTGAACTTCAGCGACGTGCAGGGCCGCTGTACCGTGGAGTACGGGGAAGACCTACTTGAGA
GCATCCAGGATTATTCACAAGGGGGCCCTGACCGCTTCTACTTCCTCGAGGCCTACAATTCAAAGACCAA
GAACTTTGAAGACCCACCAAACCATGCCCGCAGCCCTGGGAACAAAGGGAAAGGGAAGGGGAAAGGGAAG
GGGAAGGGGAAGCATCAGGTGTCAGAGCCCAAAGAGCCTGAGGCAGCCATCAAACTGCCCAAGCTCCGGA
CCCTGGATGTGTTTTCCGGCTGTGGAGGGTTATCGGAAGGATTCCACCAAGCAGGCATCTCGGAAACGCT
GTGGGCCATCGAGATGTGGGACCCGGCAGCCCAGGCATTTCGGCTGAACAACCCCGGCACCACAGTGTTC
ACAGAGGACTGCAACGTGCTTCTTAAGCTGGTCATGGCTGGGGAGGTGACCAACTCTCTGGGCCAAAGGC
TGCCACAGAAGGGCGATGTGGAGATGCTGTGTGGTGGGCCACCCTGCCAGGGCTTCAGTGGCATGAACCG
CTTCAACTCCCGCACTTACTCCAAGTTCAAAAACTCCCTAGTGGTCTCCTTCCTCAGCTACTGTGACTAC
TACCGGCCTCGGTTCTTCCTTCTGGAGAACGTCAGGAACTTCGTGTCCTACAGACGCTCCATGGTGCTGA
AGCTCACACTGCGCTGCCTGGTCCGCATGGGCTACCAGTGCACCTTTGGTGTGCTCCAGGCTGGACAGTA
TGGCGTGGCCCAGACACGAAGGAGGGCCATCATCTTGGCTGCAGCCCCAGGAGAAAAGCTGCCTCTGTTC
CCAGAGCCTCTGCATGTGTTTGCGCCCCGTGCCTGCCAGCTGAGCGTTGTGGTGGATGACAAGAAGTTTG
TTAGCAACATAACGAGGCTGAGCTCGGGGCCCTTCCGAACCATCACCGTGCGAGACACCATGTCTGACCT
CCCCGAGATCCAGAATGGAGCCTCGAATTCTGAGATCCCCTACAATGGAGAGCCACTGTCCTGGTTCCAG
AGGCAGCTGCGAGGATCACACTACCAGCCCATCCTCAGGGACCATATCTGCAAGGACATGAGCCCACTGG
TGGCTGCCCGCATGCGGCACATCCCACTGTTCCCAGGATCAGATTGGCGTGACCTGCCCAACATACAGGT
GCGGCTGGGAGATGGCGTCATAGCCCATAAGCTACAGTACACCTTTCATGATGTGAAAAATGGCTACAGC
AGCACCGGTGCCCTGCGTGGAGTCTGTTCCTGTGCAGAAGGCAAGGCCTGCGACCCTGAGTCCAGGCAAT
TCAGCACCCTCATCCCCTGGTGCCTGCCGCACACTGGGAACCGGCACAACCACTGGGCTGGCCTCTACGG
GCGTCTGGAGTGGGATGGCTTCTTCAGCACCACTGTCACCAACCCTGAGCCCATGGGCAAGCAGGGTCGG
GTGCTCCACCCGGAGCAGCACCGGGTCGTGAGTGTTCGGGAATGTGCCCGCTCCCAGGGCTTTCCAGATA
GCTACCGGTTCTTCGGCAACATCCTGGACAGACACCGGCAGGTGGGTAATGCTGTGCCACCACCCCTGGC
CAAAGCCATTGGCCTGGAGATTAAGCTCTGCCTGCTGTCCAGTGCTCGGGAGAGCGCATCAGCTGCAGTT
AAAGCAAAAGAGGAGGCTGCTACCAAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG212056 representing NM_010066
Red=Cloning site Green=Tags(s)

MPARTAPARVPALASPAGSLPDHVRRRLKDLERDGLTEKECVREKLNLLHEFLQTEIKSQLCDLETKLHK
EELSEEGYLAKVKSLLNKDLSLENGTHTLTQKANGCPANGSRPTWRAEMADSNRSPRSRPKPRGPRRSKS
DSDTLSVETSPSSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKRRVVDTESGA
AAAVEKLEEVTAGTQLGPEEPCEQEDDNRSLRRHTRELSLRRKSKEDPDREARPETHLDEDEDGKKDKRS
SRPRSQPRDPAAKRRPKEAEPEQVAPETPEDRDEDEREEKRRKTTRKKLESHTVPVQSRSERKAAQSKSV
IPKINSPKCPECGQHLDDPNLKYQQHPEDAVDEPQMLTSEKLSIYDSTSTWFDTYEDSPMHRFTSFSVYC
SRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNLGPINQWWLSGFDGGEKVLIGFSTAFA
EYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQNNPDAVYEDLINKIETTVPPSTINVNRFTEDSLLRHA
QFVVSQVESYDEAKDDDETPIFLSPCMRALIHLAGVSLGQRRATRRVMGATKEKDKAPTKATTTKLVYQI
FDTFFSEQIEKYDKEDKENAMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVK
EADDDEEADDDVSEMPSPKKLHQGKKKKQNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIP
DDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVLGATSDPLELFLVGECENMQLSYIHSKVKVIYK
APSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQPTEDNKHKFCLSCIRLAELRQKE
MPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKY
SDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWSDE
EAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGK
GKGKHQVSEPKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVF
TEDCNVLLKLVMAGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDY
YRPRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLF
PEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQ
RQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVRLGDGVIAHKLQYTFHDVKNGYS
STGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGR
VLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSARESASAAV
KAKEEAATKD

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_010066
ORF Size 4857 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010066.3, NP_034196
RefSeq Size 5367
RefSeq ORF 4860
Locus ID 13433
Cytogenetics 9 A3|9 7.66 cM
Gene Summary This gene encodes a methyltransferase that preferentially methylates cytosines of CpG residues in hemimethylated DNA to generate fully methylated CpG base pairs during DNA replication. This enzyme plays roles in diverse cellular processes including cell cycle regulation, DNA repair, and telomere maintenance. The encoded protein is composed of an N-terminal domain with a nuclear localization sequence and replication fork-targeting domain, a DNA-binding CXXC domain, two bromo-adjacent homology domains, and a C-terminal catalytic domain. Mouse embryonic stem cells mutant for this gene are viable, but when introduced into the germ line, cause a recessive lethal phenotype with mutant embryos displaying stunted growth and developmental defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)