Mthfr (NM_010840) Mouse Tagged ORF Clone

CAT#: MG209788

Reviews ()
Write a review
  • TrueORF®

Mthfr (GFP-tagged) - Mouse 5,10-methylenetetrahydrofolate reductase (Mthfr)



  "NM_010840" in other vectors (4)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 605.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Mthfr
Synonyms AI323986
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG209788 representing NM_010840
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAACGAGGCCAGAGGAAGTGGCAGTCCCAACCCGCGATCTGAGGGCAGCAGCAGTGGCAGCGAGA
GTTCCAAGGACAGTTCAAGATGTTCCACCCCCAGCCTGGACCCAGAGCGGCACGAGAGACTCCGGGAGAA
GATGAGGCGCAGAATGGACTCTGGTGACAAGTGGTTCTCCCTGGAGTTCTTCCCCCCTCGAACTGCTGAG
GGAGCTGTTAACCTCATCTCCAGGTTTGACCGGATGGCAGCAGGGGGCCCCCTCTTCGTAGATGTTACCT
GGCACCCAGCTGGAGACCCTGGCTCAGACAAGGAGACCTCCTCCATGATGATCGCCAGCACAGCAGTAAA
CTACTGCGGCTTGGAAACCATCCTGCATATGACCTGCTGCCAGCAGCGCCCGGAGGAGATCACAGGCCAT
CTGCACAGAGCCAAGCAGCTGGGCCTGAAGAACATAATGGCGCTGAGGGGAGACCCTGTAGGTGACCACT
GGGAAGCAGAGGAAGGAGGCTTCAGCTATGCCACAGACCTGGTGAAGCACATCCGGACCGAGTTTGCTGA
CTATTTTGACATCTGTGTGGCAGGTTACCCCAGAGGCCACCCCGATGCAGAGAGCTTCGAGGATGACCTG
AAGCATTTGAAGGAGAAGGTATCTGCAGGCGCCGACTTCATTATCACTCAGCTCTTCTTTGAGGCCAGCA
CCTTCTTCAGCTTTGTGAAGGCCTGCACAGAGATAGGCATCTCTTGCCCTATCCTGCCTGGGATCTTCCC
TATTCAGGGCTACACTTCCCTTCGGCAGCTTGTAAAACTGTCCAAGCTGGAGGTGCCACAGAAGATCAAG
GATGTAATTGAGCCCATCAAAGACAACGATGCTGCCATCCGCAACTACGGCATTGAGCTGGCTGTAAGCC
TGTGCCGGGAGCTGCTGGACAGTGGCTTGGTGCCAGGCCTCCACTTCTATACCCTCAACCGCGAGGTGGC
CACCATGGAGGTGCTAAAGCAACTGGGCATGTGGACCGAGGACCCCAGGCGTCCCTTGCCCTGGGCTCTC
AGTGCGCATCCCAAGCGCCGGGAGGAAGATGTCCGTCCCATCTTCTGGGCCTCCAGACCAAAGAGCTACA
TCTACCGCACACAGGACTGGGATGAGTTTCCTAACGGCCGCTGGGGTAATTCTTCCTCACCAGCCTTTGG
GGAGCTGAAAGACTACTACCTCTTCTACCTGAAAAGCAAGTCCCCCAGGGAGGAGCTGCTGAAGATGTGG
GGCGAGGAGCTCACCAGCGAAGAGAGTGTCTTTGAAGTCTTTGAACACTACCTCTCTGGAGAGCCGAATC
GCCATGGCTACAGAGTAACCTGCCTGCCCTGGAACGATGAACCCCTGGCAGCGGAAACCAGCCTGATGAA
GGAAGAGCTGCTCCGCGTGAACAGGCTGGGCATCCTCACCATCAACTCTCAGCCCAACATCAACGCAAAA
CCATCCTCAGACCCTGTTGTGGGCTGGGGCCCCAGTGGGGGTTATGTCTTCCAGAAGGCCTACCTCGAAT
TCTTCACCTCCCGTGAAACTGTGGAGGCGCTTCTGCAGGTGCTGAAGACATACGAGCTGCGGGTCAACTA
CCACATCGTGGACGTGAAGGGAGAGAACATCACTAATGCCCCTGAGCTGCAGCCCAATGCCGTGACGTGG
GGCATCTTCCCGGGTCGAGAGATCATCCAGCCTACTGTGGTGGACCCCATCAGCTTCATGTTCTGGAAGG
ATGAGGCCTTTGCCCTGTGGATCGAGCAGTGGGGCAAGCTATACGAGGAGGAGTCGCCATCCCGCATGAT
CATCCAATACATCCATGACAACTATTTCCTGGTCAACCTGGTGGACAACGAGTTCCCGCTGGACAGCTGC
CTGTGGCAGGTGGTGGAGGACACGTTTGAGCTGCTCAACAGGCATCCCACGGAGAGAGAGACACAGGCTC
CA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG209788 representing NM_010840
Red=Cloning site Green=Tags(s)

MVNEARGSGSPNPRSEGSSSGSESSKDSSRCSTPSLDPERHERLREKMRRRMDSGDKWFSLEFFPPRTAE
GAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGH
LHRAKQLGLKNIMALRGDPVGDHWEAEEGGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDL
KHLKEKVSAGADFIITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIK
DVIEPIKDNDAAIRNYGIELAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTEDPRRPLPWAL
SAHPKRREEDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPREELLKMW
GEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEPLAAETSLMKEELLRVNRLGILTINSQPNINAK
PSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTW
GIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSC
LWQVVEDTFELLNRHPTERETQAP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010840
ORF Size 1962 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010840.3, NP_034970.2
RefSeq Size 6008 bp
RefSeq ORF 1965 bp
Locus ID 17769
UniProt ID Q9WU20
Cytogenetics 4 78.67 cM
Gene Summary Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Mthfr"
Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 704.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 385.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.