Arx (NM_007492) Mouse Tagged ORF Clone

CAT#: MG208926

Reviews ()
Write a review
  • TrueORF®

Arx (GFP-tagged) - Mouse aristaless related homeobox gene (Drosophila) (Arx)



  "NM_007492" in other vectors (4)

USD 650.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Arx (NM_007492) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Arx
Synonyms Arx1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG208926 representing NM_007492
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAATCAGTACCAGGAAGAGGGCTGCTCTGAGAGGCCGGAGTGCAAGAGTAAATCTCCAACTTTGC
TCTCCTCCTACTGCATCGACAGCATCCTGGGCCGGAGAAGCCCATGCAAAATGAGGCTTCTGGGAGCCGC
GCAGAGCTTGCCTGCCCCGCTGGCCAGCCGCGCTGACCAGGAAAAAGCCATGCAAGGCTCCCCCAAGAGC
AGCAGCGCCCCGTTCGAGGCTGAGCTGCACCTGCCACCCAAGCTGCGGCGCCTCTACGGCCCGGGCGGGG
GCCGCCTCCTCCAGGGCGCGGCGGCGGCGGCTGCAGCGGCGGCGGCGGCCGCAGCGGCGGCCACGGCCAC
TGGCACCGCAGGTCCCCGTGGAGAGGTTCCTCCACCGCCACCACCAGCTGCACGGCCAGGGGAGCGTCAG
GACAGCGCAGGGGCCGTGGCTGCCGCCGCTGCCGCCGCTGCCTGGGACACGCTCAAGATCAGCCAGGCGC
CGCAGGTGAGCATCAGTCGTAGCAAGTCGTACCGCGAGAACGGGGCGCCCTTCGTGCCCCCGCCGCCAGC
CCTGGACGAGCTGAGTGGCCCGGGGGGCGTCGCGCACCCCGAGGAGCGCCTCAGCGCGGCCAGCGGACCC
GGCAGTGCCCCCGCGGCGGGTGGTGGCACGGGCGCCGAGGACGACGAGGAGGAGCTGTTGGAGGATGAGG
AAGATGAAGAGGAGGAAGAGGAGCTGCTGGAGGACGACGACGAGGAGCTGCTGGAGGACGATGCCCGCGC
GCTGCTCAAGGAGCCCCGGCGCTGCTCGGTGGCCACCACCGGCACAGTGGCCGCCGCCGCCGCCGCTGCT
GCCGCCGCCGTGGCCACCGAGGGCGGGGAGCTGTCGCCCAAGGAAGAGCTGTTGCTGCACCCGGAGGACG
CCGAGGGCAAGGATGGTGAGGACAGCGTGTGCCTGTCGGCCGGCAGCGACTCGGAGGAGGGGCTGCTGAA
GCGCAAACAGAGGCGCTACCGCACCACGTTCACCAGTTACCAGCTGGAGGAACTGGAGCGGGCTTTCCAG
AAGACGCACTACCCTGACGTCTTCACCAGGGAGGAGCTGGCCATGAGGCTGGACCTGACAGAGGCCCGAG
TCCAGGTGTGGTTCCAGAACCGTCGGGCCAAGTGGCGCAAGCGGGAGAAGGCTGGCGCACAGACCCACCC
CCCGGGGCTGCCCTTTCCAGGGCCGCTCTCGGCTACCCACCCTCTCAGCCCCTACCTGGACGCCAGCCCC
TTTCCCCCGCATCACCCTGCGCTTGATTCGGCCTGGACCGCCGCGGCGGCGGCGGCTGCAGCTGCCTTCC
CGAGCCTACCTCCGCCCCCAGGCTCTGCTAGCCTGCCACCCAGCGGGGCGCCGCTGGGTCTGAGCACTTT
TCTAGGAGCAGCGGTGTTCCGCCACCCAGCCTTCATCAGCCCAGCATTTGGCAGGCTCTTTTCCACTATG
GCCCCCCTGACCAGCGCGTCGACTGCGGCTGCGCTCCTGAGACAGCCCACACCCGCGGTGGAGGGCGCAG
TGGCCTCGGGCGCGCTGGCCGACCCGGCCACCGCCGCGGCAGACAGACGCGCGTCAAGCATAGCCGCGCT
GAGGCTCAAGGCTAAGGAGCACGCCGCGCAGCTCACGCAGCTCAACATCCTGCCGGGCACCAGCACGGGG
AAGGAGGTGTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG208926 representing NM_007492
Red=Cloning site Green=Tags(s)

MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLASRADQEKAMQGSPKS
SSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAATATGTAGPRGEVPPPPPPAARPGERQ
DSAGAVAAAAAAAAWDTLKISQAPQVSISRSKSYRENGAPFVPPPPALDELSGPGGVAHPEERLSAASGP
GSAPAAGGGTGAEDDEEELLEDEEDEEEEEELLEDDDEELLEDDARALLKEPRRCSVATTGTVAAAAAAA
AAAVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQ
KTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPGPLSATHPLSPYLDASP
FPPHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTM
APLTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPGTSTG
KEVC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007492
ORF Size 1692 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007492.3, NP_031518.2
RefSeq Size 2759 bp
RefSeq ORF 1695 bp
Locus ID 11878
Cytogenetics X 41.05 cM
Gene Summary This gene encodes a transcription factor that plays an important role in the development of forebrain. Male mice lacking this gene have smaller brains, olfactory bulbs and testes, and die within half a day after birth. Mice lacking this gene specifically in ganglionic eminence-derived neurons, including cortical interneurons, develop seizures. Mutations in this gene have been demonstrated to cause mouse phenotypes resembling human X-linked lissencephaly and cognitive disability with epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Citations (1)

Other Versions

Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal Anti-ARX Antibody
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools