Cyp3a11 (BC010528) Mouse Tagged ORF Clone

CAT#: MG208124

Cyp3a11 (GFP-tagged) - Mouse cytochrome P450, family 3, subfamily a, polypeptide 11 (cDNA clone MGC:18636 IMAGE:4194909)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 711.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Cyp3a11 (BC010528) Mouse Tagged ORF Clone
Symbol Cyp3a11
Synonyms IIIAm1
Vector pCMV6-AC-GFP
Sequence Data
>MG208124 representing BC010528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTGGTTTCAGCTCTCTCACTGGAAACCTGGGTGCTCCTAGCAATCAGCTTGGTGCTCCTCTACC
GATATGGGACTCGTAAACATGAACTTTTTAAGAAACAGGGAATTCCTGGGCCCAAACCTCTGCCATTTTT
AGGCACTGTGCTGAATTATTACAAGGGTTTATGGAAATTCGACATGGAGTGCTATAAAAAGTATGGAAAA
ACATGGGGGTTGTTTGATGGTCAAACGCCTCTCCTTGCTGTCACAGACCCAGAGACGATTAAGAATGTGC
TAGTGAAGGAATGTTTTTCTGTCTTCACAAACCGGCGGGATTTTGGCCCAGTGGGGATAATGAGTAAAGC
TATCTCAATATCTAAGGATGATGAATGGAAGAGATATAGAGCTTTGCTGTCCCCCACATTCACCAGTGGA
AAACTCAAGGAGATGTTCCCTGTCATTGAACAGTATGGAGACATTTTGGTAAAGTACTTGAGGCAGAAGG
CAAAGAAAGGCAAGCCTGTTACTATGAAAGATGTGTTAGGTGCTTACAGCATGGATGTGATCACCAGCAC
ATCATTTGGAGTGAACGTGGATTCCCTCAACAACCCAGAGGATCCTTTTGTGGAGAAAGCCAAAAAGCTT
TTAAGATTTGATTTTTTTGATCCTTTGCTCTTCTCAGTAGTACTTTTTCCATTCCTGACACCAGTATATG
AGATGTTAAATATCTGCATGTTCCCAAAGGATTCAATAGAATTTTTCAAAAAATTTGTGGACAGAATGAA
GGAAAGCCGCCTGGATTCTAAGCAGAAGCACCGAGTGGATTTTCTTCAGCTGATGATGAATTCTCATAAT
AATTCCAAAGACAAAGTCTCTCATAAAGCCCTTTCTGACATGGAGATCACAGCCCAGTCAATTATCTTTA
TTTTTGCTGGGTATGAAACCACCAGTAGCACACTTTCCTTCACCCTGCATTCCTTGGCCACTCACCCTGA
TATCCAGAAAAAACTGCAGGATGAGATCGATGAGGCTCTGCCCAACAAGGCACCTCCCACGTATGATACT
GTGATGGAGATGGAATACCTGGATATGGTGCTTAATGAAACCCTCAGATTATATCCCATTGCTAATAGAC
TTGAGAGAGTCTGTAAGAAAGATGTTGAACTCAATGGTGTGTATATCCCCAAAGGGTCAACAGTGATGAT
TCCATCTTATGCTCTTCACCATGACCCACAGCACTGGTCAGAGCCTGAAGAATTCCAACCTGAAAGGTTC
AGCAAGGAGAACAAGGGCAGCATTGATCCTTATGTATATCTGCCCTTTGGGAATGGACCCAGGAACTGCC
TTGGCATGAGGTTTGCTCTCATGAATATGAAACTTGCTCTCACTAAAATTATGCAGAACTTCTCCTTCCA
GCCTTGTAAGGAAACACAGATACCTCTGAAATTAAGCAGACAAGGACTTCTTCAACCAGAAAAACCCATT
GTTCTAAAGGTTGTGCCACGGGATGCAGTCATAACTGGAGCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG208124 representing BC010528
Red=Cloning site Green=Tags(s)

MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYKKYGK
TWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISISKDDEWKRYRALLSPTFTSG
KLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKL
LRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHN
NSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDT
VMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERF
SKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPI
VLKVVPRDAVITGA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC010528
ORF Size 1514 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC010528
RefSeq Size 2070
RefSeq ORF 1514
Locus ID 13112
Cytogenetics 5 G2|5 85.17 cM
Gene Summary Catalyzes erythromycin N-demethylation, nifedipine oxidation and testosterone 6 beta-hydroxylation. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)